Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate RR42_RS00265 RR42_RS00265 phosphate ABC transporter ATP-binding protein
Query= uniprot:A0A1N7U8S3 (276 letters) >FitnessBrowser__Cup4G11:RR42_RS00265 Length = 242 Score = 239 bits (611), Expect = 3e-68 Identities = 129/251 (51%), Positives = 174/251 (69%), Gaps = 15/251 (5%) Query: 27 LQVEGIHKRYGEHEVLKGVSLNARQGDVISLIGASGSGKSTMLRCINFLEQPDAGVITLD 86 ++ + + K +G+ E+LKGVS + R G+V++LIG SGSGKST LRCIN LE+ + G + + Sbjct: 5 VRFDKVSKSFGQVEILKGVSFSVRAGEVVALIGRSGSGKSTALRCINGLERVNGGALHVC 64 Query: 87 GISIEMRQGRAGTRAPHQDQ--LQNLRTRLAMVFQHFNLWSHMTVLENITMAPRRVLDVS 144 G RA H+D L LR + +VFQ +NL+ H+TV EN+ +APR+V V Sbjct: 65 G------------RAMHEDNVPLGELRKEVGIVFQSYNLFPHLTVEENVMLAPRKVKGVG 112 Query: 145 AAEAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIARALAMEPEIILFDEPTSALD 204 EA + A L +VG+ R A YP LSGGQQQRVAIAR+LAM P ++LFDE TSALD Sbjct: 113 KKEARELAMHVLKQVGMEER-AGYYPEQLSGGQQQRVAIARSLAMRPRLMLFDEVTSALD 171 Query: 205 PELVGEVLKVIQTLAEEGRTMLMVTHEMGFARQVSSQVLFLHQGRVEEHGDARILDQPNS 264 PEL GEVLKVI+ LAE+G TM++VTHEM FAR V+ Q++F+HQG V E G ++LD+P++ Sbjct: 172 PELTGEVLKVIERLAEKGMTMVLVTHEMAFARSVADQIMFMHQGIVWEGGSGKLLDEPST 231 Query: 265 ERLQQFLSNRL 275 L+QF+ N L Sbjct: 232 PELKQFVGNGL 242 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 242 Length adjustment: 24 Effective length of query: 252 Effective length of database: 218 Effective search space: 54936 Effective search space used: 54936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory