Align Glutamate--putrescine ligase (EC 6.3.1.11) (characterized)
to candidate RR42_RS12995 RR42_RS12995 glutamine synthetase
Query= reanno::MR1:200446 (451 letters) >FitnessBrowser__Cup4G11:RR42_RS12995 Length = 471 Score = 117 bits (294), Expect = 6e-31 Identities = 105/393 (26%), Positives = 163/393 (41%), Gaps = 32/393 (8%) Query: 74 DFVCVPDENAVFMLPWTIEATAQVIHDCYDRM-GNPIELSPRNVLKKVLSLYDEKGWEPV 132 D + +PD N + P+ E T + D + G + PR++ K+ + G Sbjct: 67 DMLLMPDPNTANVDPFYEEPTLILTCDVVEPSDGKGYDRDPRSIAKRAEAYLKSTGLGDT 126 Query: 133 --IAPEMEFYL-------------TSRSDDHDLPLKP----PIGRSG-RPEAGRQSFSID 172 PE EF++ + + + P G SG RP F + Sbjct: 127 AFFGPEPEFFIFDGVTWNIDMQGCSVKIHSEEAPWSSGKEFEHGNSGHRPGKKGGYFPVA 186 Query: 173 AANEYDPLFEDMYDWCEIQGLDIDTLIHE-DGPAQMEINFSHGNPLSLADQVFVFKRTLR 231 + + + +M E G+ ++ HE G Q EI + AD + K ++ Sbjct: 187 PIDTFQDIRSEMCLILESLGIPVEVHHHEVAGQGQNEIGTKFSTLVQRADWTQLQKYVIQ 246 Query: 232 EAALKHNVCATFMAKPVTDEPGSAMHIHQSVINKETGKNIFT-NEDGTQSALFLSYIAGL 290 A + ATFM KPV + GS MH+HQSV + G+N+F N S L YI G+ Sbjct: 247 NVAHTYGKTATFMPKPVVGDNGSGMHVHQSVW--KDGQNLFAGNGYAGLSEFALYYIGGI 304 Query: 291 QKYIPEFLPLMAPNANSFRRFLPGTSAPVNLEWGIENRTCGLRIP-ESSPQNRRIENRIP 349 K+ L P NS++R +PG APV L + NR+ +RIP ++P+ RRIE R P Sbjct: 305 IKHARALNALTNPGTNSYKRLVPGFEAPVKLAYSARNRSASIRIPYVANPKGRRIETRFP 364 Query: 350 GADANCYLAFAAGLLCGYIGMVEGLKPSTPVQGKANESRSNNPHCLPLTLEEALVAMEES 409 N YL F+A L+ G G+ + P + +P A+E Sbjct: 365 DPLMNPYLGFSALLMAGLDGVQNKIHPGEAADKNLYDLPPEEDAKIPTVCSSLDQALEYL 424 Query: 410 DACKEYL------GESFTTGFVAVKQAELENFR 436 D +E+L S ++ +K E+ FR Sbjct: 425 DNDREFLTRGGVFSNSMIDAYIELKMEEVTRFR 457 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 500 Number of extensions: 33 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 451 Length of database: 471 Length adjustment: 33 Effective length of query: 418 Effective length of database: 438 Effective search space: 183084 Effective search space used: 183084 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory