Align ornithine aminotransferase; EC 2.6.1.13 (characterized)
to candidate RR42_RS16955 RR42_RS16955 acetylornithine aminotransferase
Query= CharProtDB::CH_122124 (454 letters) >FitnessBrowser__Cup4G11:RR42_RS16955 Length = 395 Score = 208 bits (530), Expect = 2e-58 Identities = 132/394 (33%), Positives = 209/394 (53%), Gaps = 21/394 (5%) Query: 38 VVFARAQGTSVWDPEGRHYLDFLSAYSAVNQGHCHPKLVAALVDQASRLTLSSRAFYNDV 97 +VF +G+ + D G+ YLDF+ ++ GH + ++ ALVDQ+ +L S AFYN+ Sbjct: 20 LVFTEGKGSWLTDHNGKRYLDFVQGWAVNCLGHSNQAMIDALVDQSKKLFNPSPAFYNEP 79 Query: 98 FPKFAEMVTKYFGFDMVLPMNTGAEAVETGIKIARKWGYKVKGIPENEAI-ILSAENNFH 156 + A +T FD V N+GAEA E IK+ARKWG K K N A I++ +++FH Sbjct: 80 MLRLARQLTDASCFDKVFFANSGAEANEGAIKLARKWGRKHK----NGAFEIITMDHSFH 135 Query: 157 GRTMAAISLSSDPESRENYGPYVPNIGCTIPGTEKPITYNDKAALREAFEKAGSNLAAFL 216 GRT+A +S S + P VP ND A++ + A + Sbjct: 136 GRTLATMSASGKAGWDTIFAPQVPGF--------PKADLNDLASVEKLI---NDKTVAIM 184 Query: 217 VEPIQGEAGIIVPDDDYLQLARSLCDQHNVLLICDEIQTGIARTGKLLCHEWSGIKPDMV 276 +EP+QGE G+I +++Q R L DQH +L I DE+QTG R G + +E SG++PD++ Sbjct: 185 LEPVQGEGGVIPASREFMQGLRKLADQHKLLFIVDEVQTGCGRCGTMFAYELSGVEPDIM 244 Query: 277 LLGKAISGGMYPVSCVLGRKDVMLTVEPGTHGSTYGGNPLACAVAIRALEVVQEENMVER 336 LGK I GG+ P++ +L + +V + E G G TY GNP+ AV + + ++ Sbjct: 245 TLGKGIGGGV-PLAALLCKAEV-ASFEAGDQGGTYNGNPVMTAVGSAVISQLTAPGFLQS 302 Query: 337 AEKLGQAFRSGLEAIQNPI-IQTVRGKGLLNAIVIDESKTNGHTAWDLCMLMKEKGLLAK 395 + G R L A+ + + RG+GLL A+V+ +K G + M+ +GLL Sbjct: 303 VQDKGAYLREQLLALTSEFGLGGERGEGLLRALVL--NKDIGPQLVEEARDMQPQGLLLN 360 Query: 396 PTHQNIIRLAPPLVITEEEIAKALEIIKAAVAEL 429 N++R P L +T EEI + + +++ + +L Sbjct: 361 SPRPNLLRFMPALNVTIEEIDQMISMLRTLLKKL 394 Lambda K H 0.316 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 454 Length of database: 395 Length adjustment: 32 Effective length of query: 422 Effective length of database: 363 Effective search space: 153186 Effective search space used: 153186 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory