Align deoxynucleoside transporter, permease component 2 (characterized)
to candidate RR42_RS03365 RR42_RS03365 ribose ABC transporter permease
Query= reanno::Burk376:H281DRAFT_01112 (364 letters) >FitnessBrowser__Cup4G11:RR42_RS03365 Length = 333 Score = 150 bits (378), Expect = 6e-41 Identities = 99/308 (32%), Positives = 161/308 (52%), Gaps = 14/308 (4%) Query: 57 LIVVTCLIVGAINPRFFQFATLFDLLHSATTMSLFALGTLVVLASGGIDVSFTAIAALTM 116 ++V+ C+ + F + L + A+ + A G V+ +GGID+S +I L++ Sbjct: 34 VLVLLCIGFSVLTENFAGWQNLSIIAQQASINMVLAAGMTFVILTGGIDLSVGSI--LSI 91 Query: 117 YGITKAVFAWWPDAPFALILVTGALGGVVLGMVNGLLVHRLKAPSLIVTIGTQYLYRGLL 176 + + + P L + L G++ G+VNG LV +K P IVT+GT RGL Sbjct: 92 SAVVAMLVSLMPQLGM-LSVPAALLCGLLFGIVNGALVAFMKLPPFIVTLGTLTAVRGLA 150 Query: 177 LTFIGTTFFMNIPHSMDRFGRIPLFFYHTADGLRAVLPVSVLALVAAAVVTWWLLNRTMM 236 +G + P + F +G +P V+ A V+W++L RT++ Sbjct: 151 -RLVGNDSTIYNPD---------IGFAFIGNGEVLGVPWLVIIAFAVVAVSWFVLRRTVL 200 Query: 237 GRAVYAMGGSLAIAERLGYNLRAIHLFVFGYTGMLAGIAGILHVSNNRLANPFDLVGS-E 295 G +YA+GG+ A G + + LFV+ +G+LAG+ G++ + AN L S E Sbjct: 201 GLQIYAVGGNAEAARLSGIKVWVVLLFVYAVSGLLAGLGGVMSSARLYAANGLQLGQSYE 260 Query: 296 LDVIAAVILGGARITGGTGTVVGTLLGVVLVTLIKSVLILVGVPSTWQKVIIGAFILLAG 355 LD IAAVILGG GGTG++VGTL+G +++ ++ + L+L+GV WQ +I G I+ A Sbjct: 261 LDAIAAVILGGTSFVGGTGSIVGTLVGALIIAVLSNGLVLLGVSDIWQYIIKGLVIIGAV 320 Query: 356 TLFALQRK 363 L + +RK Sbjct: 321 ALDSYRRK 328 Lambda K H 0.328 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 288 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 333 Length adjustment: 29 Effective length of query: 335 Effective length of database: 304 Effective search space: 101840 Effective search space used: 101840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory