Align Phosphate acetyltransferase; EC 2.3.1.8; Phosphotransacetylase (uncharacterized)
to candidate RR42_RS05210 RR42_RS05210 malic enzyme
Query= curated2:Q726S7 (704 letters) >FitnessBrowser__Cup4G11:RR42_RS05210 Length = 773 Score = 174 bits (442), Expect = 1e-47 Identities = 112/338 (33%), Positives = 171/338 (50%), Gaps = 10/338 (2%) Query: 372 RITPKMFEFNLIEK-----AKRNRMRIVLPEGAEERILRAADILVRREVADIILLGDANT 426 ++T ++ LI K AK R+V EG EER+LRA +V +A IL+G + Sbjct: 434 QLTQYVYHTGLIMKPVFTAAKAAPKRVVYAEGEEERVLRAVQTVVDEGLARPILIGRPHV 493 Query: 427 VGSRIGDLGLDMDG---VQIVQPNLSPKFDEYVAAYHECRKKKGISMEQARDMMN-DPTY 482 + RI GL + +++ P P++ Y AYH R + G++ + A+ M+ T Sbjct: 494 IQMRIDKAGLRLKAGADFELINPEDDPRYRAYHEAYHTLRGRDGVTPDVAKVMLRRSNTL 553 Query: 483 FGTMMVHKGDADGMVSGAINTTAHTIRPAFEFIKTKPGVSIVSSVFLMCLKDRVLVFGDC 542 GTM++H GDAD M+ G + + + I PG + +++ + L+ L D Sbjct: 554 IGTMLMHMGDADAMLCGTVGRFEAHLEHVRDVIGMAPGAKVFAAMNALMLEKYTLFITDT 613 Query: 543 AVNPNPTAEQLAEIAISASHTARIFGVDPRVAMLSYSTGSSGKGADVEKVIEATRIAKER 602 VN +PTAE+LA I A+ FG P+VA++S+S S K+ A I Sbjct: 614 FVNDDPTAEELAAITQLAAEEIARFGQHPKVALMSHSMFGSSDRPSARKMRAAQEILARE 673 Query: 603 APELLLEGPLQYDAAIDMDVARTKLPGSTVAGQATVFIFPDLNTGNNTYKAVQRAAG-AV 661 AP L +EG +Q DAA+ DV R LPG+ +AG A + + P L+ N + ++ G V Sbjct: 674 APHLEVEGEMQGDAALVEDVRRHFLPGTKLAGSANLLVMPTLDAANIAFNLLKITGGQGV 733 Query: 662 AIGPVLQGLNKPVNDLSRGCTVADIVNTVAITAIQAQA 699 IGP+L G KPV+ L+ T IVN A+ +A A Sbjct: 734 TIGPILLGAAKPVHILNPQATTRRIVNMTAVAVAEANA 771 Lambda K H 0.319 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1179 Number of extensions: 64 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 704 Length of database: 773 Length adjustment: 40 Effective length of query: 664 Effective length of database: 733 Effective search space: 486712 Effective search space used: 486712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (25.8 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory