Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate RR42_RS21765 RR42_RS21765 3-oxoacyl-ACP reductase
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >FitnessBrowser__Cup4G11:RR42_RS21765 Length = 246 Score = 123 bits (308), Expect = 4e-33 Identities = 80/253 (31%), Positives = 133/253 (52%), Gaps = 26/253 (10%) Query: 15 VLISGAAAGIGAAIAQAFLDVGANVYICDVDPAAIDR-ARTAHPQ------LHAGVADVS 67 +L++GA GIG A+ FL GAN+ + D+D A + AR P + A Sbjct: 9 LLLTGANGGIGRETAKLFLAQGANLVLTDLDEAGVAGFARELDPSGERIATMRMDAASPD 68 Query: 68 DCAQVDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLRK 127 DC +R + A+++ GG+D L+ +AG+ V ++ A+W +T+ NL+ FY +R+ Sbjct: 69 DC---ERAVALAQARFGGIDFLVPSAGLY-QAQPVAEMSDAQWRQTLSINLDGVFYLVRR 124 Query: 128 AVPLLKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNAI 187 A+P L+E SA I+ + SVA G + Y+ASK ++ + +SLA ELGP RVNA+ Sbjct: 125 AIPALRENSA---IVNLTSVAAHRGAYYNAHYSASKGGLLSLTRSLARELGP-RTRVNAV 180 Query: 188 LPGVVEGERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLASPAGQ 247 PGV+E +I R + +++ L+R+ ++A FL S A Sbjct: 181 SPGVIETPMTTELIQKRG-----------ADSVEQTPLKRLGHPREIATAIGFLCSDAAS 229 Query: 248 NISGQAISVDGNV 260 ++G+ + V+G + Sbjct: 230 FVTGEVLHVNGGL 242 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 10 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 246 Length adjustment: 24 Effective length of query: 239 Effective length of database: 222 Effective search space: 53058 Effective search space used: 53058 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory