Align 2-deoxy-D-ribonate transporter 1 (characterized)
to candidate RR42_RS25070 RR42_RS25070 membrane protein
Query= reanno::Koxy:BWI76_RS23715 (445 letters) >FitnessBrowser__Cup4G11:RR42_RS25070 Length = 432 Score = 335 bits (859), Expect = 2e-96 Identities = 176/430 (40%), Positives = 253/430 (58%), Gaps = 4/430 (0%) Query: 15 QRTHKKIYRHLMPLLIVAYIISFIDRTNIGMAKATMSVDIGLSATAFGLGAGLFFLTYAV 74 QR K++R L+PLLI+ Y +SF+DR N+G A M+ D+GLSATAFGLGAGLFFLTY + Sbjct: 6 QRVMPKVFRRLVPLLILCYFVSFLDRVNVGFAALQMNKDLGLSATAFGLGAGLFFLTYFL 65 Query: 75 LEIPSNLFLTRIGARRWIARIMITWGIISCGMAFVTGPTSFYVMRLLLGAAEAGLYPGII 134 E+PSNL L R GARRWIARIM+TWG++S AFVTGPT FY++RLLLG AEAG +PG+ Sbjct: 66 FEVPSNLLLVRFGARRWIARIMVTWGLVSAATAFVTGPTGFYIVRLLLGLAEAGFFPGVA 125 Query: 135 YYLTLWFGREERAKATGLFLLGVCLANIIGAPLGGLLLSLDGMSGWHGWQWMFFIEGLPA 194 Y+LTLWF RA+ G L+ ++ +IGAP+ G LL+L+G+ G HGWQWMF +E LPA Sbjct: 126 YFLTLWFPSAYRARVMGYLLVAAPMSTVIGAPISGGLLNLEGVMGLHGWQWMFILEALPA 185 Query: 195 IALAFVVWRRLPDKPADARWLDSHDVQAITAVLEKEAEETRHTPSRFSLKTALTTRVFLL 254 + L F+ R L +P+DA WL + + ++ + E E R S+ T L Sbjct: 186 VILGFIALRHLSGEPSDAPWLSADERSWLSQRMATEDRE-RRAEHHLSVAQVFFTPKVWL 244 Query: 255 LVLIYFTHQFSVYGLSYFLPGIIGSWGQLTPLQIGLLTAIPWIAAAAGGILLPRFARTEQ 314 L ++ F S++G+ +FLP I+ S+G L+ +Q G + AIP++ A+ + R + + Sbjct: 245 LSMMAFGFFLSIFGVGFFLPQIVKSFG-LSNVQTGFVAAIPYVIASLSIVFWARRSDARK 303 Query: 315 RSRSMLMAGYLVMATGMAIGAIAGHGV-ALLGFSLAAFMFFAMQSIIFNWLPSIMSGHML 373 R + + + A+ + ++ FS+AAF F + +++SG Sbjct: 304 ERRLHIAVPAFIAGVALIAAALVDDSILKMIAFSVAAFGIFGALPAFWAINTTLLSGPAS 363 Query: 374 AGSFGLLNCLGLCGGFLGPFILGAFEDRTGAATSGLWFAVALLIVGALASLLIKSSSSST 433 A + +G GGF GP +LG +D TG+ GL A+ V A +L + S+ Sbjct: 364 AAGIAFIGAVGNLGGFAGPSLLGLSKDLTGSYAGGLMILAAVAFVAAAVALGV-GRRSNP 422 Query: 434 PASAKQARGE 443 PA A GE Sbjct: 423 PAIALTPTGE 432 Lambda K H 0.328 0.141 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 529 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 432 Length adjustment: 32 Effective length of query: 413 Effective length of database: 400 Effective search space: 165200 Effective search space used: 165200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory