Align 2-deoxy-3-keto-D-ribonoate cleavage enzyme (characterized)
to candidate RR42_RS25175 RR42_RS25175 3-keto-5-aminohexanoate cleavage protein
Query= reanno::WCS417:GFF1426 (310 letters) >FitnessBrowser__Cup4G11:RR42_RS25175 Length = 307 Score = 418 bits (1075), Expect = e-122 Identities = 201/304 (66%), Positives = 241/304 (79%) Query: 7 VIITCAVTGAIHTPSMSPHLPITAQEIADAAIGAAEAGAAIVHLHARDPNDGRPSQDPAL 66 VIITCAVTGAIHTPSMS +LP+T +EI +A++GAAEAGAAI+HLHARDP G+P Q P Sbjct: 4 VIITCAVTGAIHTPSMSRYLPVTPEEITEASVGAAEAGAAIIHLHARDPVTGKPDQSPDA 63 Query: 67 FAEFLPQIKAASDVVINITTGGAPTMGVEERLQPVMQFKPELASLNMGSMNFGLYEMLNR 126 F FLPQIKA +D V+NIT+GG+P M +EER+QP M+F PE+ASLNMGSMNF L+ ML R Sbjct: 64 FGRFLPQIKARTDAVLNITSGGSPYMTIEERIQPSMRFAPEVASLNMGSMNFALFPMLAR 123 Query: 127 FTDFKHDWERPYLEESDDRIFRNTFRDITHILNACAENRTRFEIECYDIGHLYTAAHFLE 186 F +FKH WER LE S D IFRNTF+DI + L CA N TRFE ECYD+ HLY AHF+E Sbjct: 124 FKEFKHAWEREALEASRDLIFRNTFKDIEYALAQCAANDTRFEFECYDVSHLYNLAHFVE 183 Query: 187 RGLLKPPLFIQSVFGLRGGIGGHPEDLAHMRRTADRLFGSDYVWSILGAGRGQIPLATMG 246 RGL+K P F+Q+VFG+ GGIG HPED+ HM+RTADRLFG+DY WS+LGAG+ Q+ LA M Sbjct: 184 RGLVKAPFFVQTVFGILGGIGTHPEDVLHMKRTADRLFGNDYRWSVLGAGKDQLRLAAMS 243 Query: 247 LSMGSNARVGLEDSLWDGPGKLAASNADQVRRIRTVIEALGHRVATPDEAREILGLKGRD 306 SMG N RVGLEDSLW G G LA SNA QVR++R +IE LG +A+P+EAR+IL LKG Sbjct: 244 ASMGGNVRVGLEDSLWLGRGTLAESNAAQVRQVRQIIEGLGLEIASPNEARDILQLKGIG 303 Query: 307 QVNF 310 +V F Sbjct: 304 KVGF 307 Lambda K H 0.321 0.138 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 307 Length adjustment: 27 Effective length of query: 283 Effective length of database: 280 Effective search space: 79240 Effective search space used: 79240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory