Align propionate kinase (EC 2.7.2.15) (characterized)
to candidate RR42_RS03800 RR42_RS03800 acetate kinase
Query= BRENDA::O06961 (402 letters) >FitnessBrowser__Cup4G11:RR42_RS03800 Length = 408 Score = 262 bits (669), Expect = 2e-74 Identities = 167/405 (41%), Positives = 243/405 (60%), Gaps = 27/405 (6%) Query: 5 PVVLVINCGSSSIKFSVLDV-----ATCD---VLMA-------GIADGMNTENAFLSING 49 P +LV+N GSSS+K SV V A D VL A G++ ++ A I Sbjct: 6 PTILVVNAGSSSVKVSVYAVPEAAHANADINPVLSAHGQIEGIGVSPRLSASMADGRIVA 65 Query: 50 DKPINLAH-SNYEDALKAIAFELEKRDLTDSVALIGHRIAHGGELFTQSVIITDEIIDNI 108 D+ +A ++++ A + I L IGHR+ HGG F+ +V I D++I + Sbjct: 66 DERFPVAQVADHDAAFRLIRLVLSIGLRDAPPVAIGHRVVHGGADFSAAVKIDDDVITKL 125 Query: 109 RRVSPLAPLHNYANLSGIDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLG 168 + PLAPLH NL+ I A R PA+ QVA FDT+FH P A L LP+EYF G Sbjct: 126 EALIPLAPLHQPHNLTAIRAVRAAVPALLQVACFDTAFHAGHDPLAQLLALPYEYFER-G 184 Query: 169 VRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPL 228 +RRYGFHG S+ Y++RR ++ D +IVAHLGNGAS+CA+R+G+SV+++MG+T L Sbjct: 185 IRRYGFHGLSYEYIARRLQQIAP-DLAQGRVIVAHLGNGASLCAMRDGRSVESTMGLTAL 243 Query: 229 EGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAWHE 288 +GL MGTR G +D GA+ W++++ G + D+E ++ +ESGL G+SG+SSD+R L + Sbjct: 244 DGLPMGTRCGAIDAGAILWLSQQ-GMSTKDIETMLYQESGLKGLSGVSSDMRALLAS--- 299 Query: 289 GHERARLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLG-VLGL 347 RARLAI + +R A+ I AA+L LD ++FT GIG NS +R+ + L + G+ Sbjct: 300 DAPRARLAIDFYAYRAAQEIGKLAATLGGLDALVFTAGIGANSPPVREKICARLADLFGI 359 Query: 348 TLDVEMNKQPNSHGERIISANPSQVICAVIPTNEEKMIALDAIHL 392 +LD N N + +R IS + S+V V+PT+EE MIAL+ + Sbjct: 360 SLDAGAN---NENRQR-ISRDNSRVPVLVLPTDEEGMIALNTARI 400 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 396 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 408 Length adjustment: 31 Effective length of query: 371 Effective length of database: 377 Effective search space: 139867 Effective search space used: 139867 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate RR42_RS03800 RR42_RS03800 (acetate kinase)
to HMM TIGR00016 (ackA: acetate kinase (EC 2.7.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00016.hmm # target sequence database: /tmp/gapView.16987.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00016 [M=405] Accession: TIGR00016 Description: ackA: acetate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-110 353.9 0.0 6e-110 353.6 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS03800 RR42_RS03800 acetate kinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS03800 RR42_RS03800 acetate kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 353.6 0.0 6e-110 6e-110 4 404 .. 6 401 .. 3 402 .. 0.88 Alignments for each domain: == domain 1 score: 353.6 bits; conditional E-value: 6e-110 TIGR00016 4 kkilvlnaGssslkfalldaensekv........llsglverikleeariktvedge..kkeee.klai 61 ilv+naGsss+k +++ ++ + ++g +e i ++ + dg e++ + ++ lcl|FitnessBrowser__Cup4G11:RR42_RS03800 6 PTILVVNAGSSSVKVSVYAVPEAAHAnadinpvlSAHGQIEGIGVSPRLSASMADGRivADERFpVAQV 74 679***************988744333444554346789999999988777666665222333314567 PP TIGR00016 62 edheeavkkllntlkkdkkilkelseialiGHRvvhGgekftesvivtdevlkkikdiselAPlHnpae 130 +dh++a + + l i + +iGHRvvhGg +f+ +v ++d+v+ k++ +++lAPlH p + lcl|FitnessBrowser__Cup4G11:RR42_RS03800 75 ADHDAAFRLIRLVLS----IGLRDAPPVAIGHRVVHGGADFSAAVKIDDDVITKLEALIPLAPLHQPHN 139 777777766655555....6667777789**************************************** PP TIGR00016 131 legieavlklkvllkaknvavFDtafHqtipeeaylYalPyslykelgvRrYGfHGtshkyvtqraakl 199 l++i+av ++ +va+FDtafH a l alPy++++ g+RrYGfHG+s++y+++r++++ lcl|FitnessBrowser__Cup4G11:RR42_RS03800 140 LTAIRAVR--AAVPALLQVACFDTAFHAGHDPLAQLLALPYEYFE-RGIRRYGFHGLSYEYIARRLQQI 205 ********..5666667************************9885.7*******************998 PP TIGR00016 200 lnkplddlnlivcHlGnGasvsavknGksidtsmGltPLeGlvmGtRsGdiDpaiisylaetlglslde 268 l++ ++iv+HlGnGas++a+++G+s++ +mGlt L+Gl mGtR+G iD ++i +l+ ++g+s+++ lcl|FitnessBrowser__Cup4G11:RR42_RS03800 206 APD-LAQGRVIVAHLGNGASLCAMRDGRSVESTMGLTALDGLPMGTRCGAIDAGAILWLS-QQGMSTKD 272 766.99****************************************************96.68****** PP TIGR00016 269 ieetlnkksGllgisglssDlRdildkkeegneeaklAlkvyvhRiakyigkyiaslegelDaivFtgG 337 ie++l ++sGl g+sg+ssD+R +l+ +a+lA++ y++R a+ igk +a+l g lDa+vFt+G lcl|FitnessBrowser__Cup4G11:RR42_RS03800 273 IETMLYQESGLKGLSGVSSDMRALLASD---APRARLAIDFYAYRAAQEIGKLAATLGG-LDALVFTAG 337 ************************9887...679***********************76.********* PP TIGR00016 338 iGenaaevrelvlekle.vlGlkldlelnnaarsgkesvisteeskvkvlviptneelviaeDalrla 404 iG n+ vre+++ +l+ ++G+ ld nn ++ + is ++s+v vlv+pt+ee +ia +++r++ lcl|FitnessBrowser__Cup4G11:RR42_RS03800 338 IGANSPPVREKICARLAdLFGISLDAGANN----ENRQRISRDNSRVPVLVLPTDEEGMIALNTARIM 401 **************997367********99....66778**********************9999875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (405 nodes) Target sequences: 1 (408 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.00 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory