Align alcohol dehydrogenase (cytochrome c) (EC 1.1.2.8) (characterized)
to candidate RR42_RS21615 RR42_RS21615 alcohol dehydrogenase
Query= BRENDA::C7G3B8 (472 letters) >FitnessBrowser__Cup4G11:RR42_RS21615 Length = 1000 Score = 232 bits (592), Expect = 4e-65 Identities = 142/390 (36%), Positives = 208/390 (53%), Gaps = 27/390 (6%) Query: 34 IKKGEYVARLGDCVACHTSLNGQKYAGGLSIKTPIGTIYSTNITPDPTYGIGTYTFKEFD 93 I++G VA GDC CHT+ NG + AGGL++ TP GTIYSTNITPD GIG +++ F+ Sbjct: 604 IERGRLVAAAGDCAVCHTAPNGARNAGGLALDTPFGTIYSTNITPDVETGIGNWSYAAFE 663 Query: 94 EAVRHGVRKDGATLYPAMPYPSFARMTQDDMKALYAYFMHGAQPIAQKNHPTDISWPMSM 153 A+R G+ +DG LYPA PY +FA+ + D++ALYAY M A+P+ K T +++P ++ Sbjct: 664 RAMRQGIHRDGRHLYPAFPYTAFAKTSDGDLQALYAYLM-AAEPVRAKAPETALAFPYNL 722 Query: 154 RWPLSIWRSVFAPAPKDFTPAPGTDAEIARGEYLVTGPGHCGACHTPRGFGMQEKALDAS 213 R ++ W +F +PK F P A+ RG YL G GHC ACH+PR AL A Sbjct: 723 RPLMAGWNLLF-HSPKPFEADPARSAQWNRGAYLAEGLGHCSACHSPR------NALGAE 775 Query: 214 GGPDFLGGGGVIDNWIAPS---LRNDPVLGLGRWSDEDLFLFLKSG-RTDHSAAFGGMAD 269 G GGG + W AP+ L + PV W+++ LF +L++G H AA G MA Sbjct: 776 QGGRRYLGGGEAEGWEAPALGKLSHAPV----PWTEQALFSYLRTGYAPHHGAAAGPMAP 831 Query: 270 VVGWSTQYFTDADLHAMVKYIKSLPPVPPARGDYSYDASTAQM--LDSNNISGNAGAKTY 327 V+ + D+ A+ Y+ S P S A + D+ G A+ Y Sbjct: 832 VIE-ELALLPEEDVRAIAHYVASFGDAQPDAALASAQARQLEQRSADAARTLGGPAARLY 890 Query: 328 VDQCAICHRNDGGGVARMF---PPLAGNPVVVSDNPTSVAHIVVDGGVLPPTNWAPSAVA 384 + CA+CH++D G R F P LA N + D P ++ +++DG PT Sbjct: 891 QNACAVCHQSDQG--IRQFGIKPSLALNTNLHGDKPDNLIRVLLDG---IPTPGTSDLGY 945 Query: 385 MPDYKNILSDQQIADVVNFIRSAWGNRAPA 414 MP + L D+Q+ +V+++R + PA Sbjct: 946 MPAFGESLDDRQLTQLVHYLRKRFAPDKPA 975 Lambda K H 0.318 0.135 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1406 Number of extensions: 84 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 472 Length of database: 1000 Length adjustment: 39 Effective length of query: 433 Effective length of database: 961 Effective search space: 416113 Effective search space used: 416113 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory