Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate RR42_RS03365 RR42_RS03365 ribose ABC transporter permease
Query= uniprot:D8J112 (347 letters) >FitnessBrowser__Cup4G11:RR42_RS03365 Length = 333 Score = 220 bits (560), Expect = 5e-62 Identities = 133/328 (40%), Positives = 198/328 (60%), Gaps = 14/328 (4%) Query: 23 GLRARLFNPAARQKLLAFASLLLMILFFSFASPNFMEVDNLVSILQSTAVNGVLAIACTY 82 G RL + L L+L+ + FS + NF NL I Q ++N VLA T+ Sbjct: 15 GTLGRLTTQERLRALGMLPVLVLLCIGFSVLTENFAGWQNLSIIAQQASINMVLAAGMTF 74 Query: 83 VIITSGIDLSVGTMMTFCAVMAGVV--LTNWGMPLPLGIAAAIFFGALSGWISGMVIAKL 140 VI+T GIDLSVG++++ AV+A +V + GM L + AA+ G L G ++G ++A + Sbjct: 75 VILTGGIDLSVGSILSISAVVAMLVSLMPQLGM---LSVPAALLCGLLFGIVNGALVAFM 131 Query: 141 KVPPFIATLGMMMLLKGLSLVISGTRPIYFNDTEGFSAIAQDSLIGDLIPSLPIPNAVLI 200 K+PPFI TLG + ++GL+ ++ IY N GF+ I ++G +P V+I Sbjct: 132 KLPPFIVTLGTLTAVRGLARLVGNDSTIY-NPDIGFAFIGNGEVLG-------VPWLVII 183 Query: 201 LFLVAIGASIILNKTVFGRYTFALGSNEEALRLSGVKVDFWKVAVYTFSGAICGIAGLII 260 F V + +L +TV G +A+G N EA RLSG+KV + VY SG + G+ G++ Sbjct: 184 AFAVVAVSWFVLRRTVLGLQIYAVGGNAEAARLSGIKVWVVLLFVYAVSGLLAGLGGVMS 243 Query: 261 ASRLNSAQPA-LGQGYELDAIAAVVIGGTSLSGGTGTILGTIIGAFIMSVLVNGLRIMSV 319 ++RL +A LGQ YELDAIAAV++GGTS GGTG+I+GT++GA I++VL NGL ++ V Sbjct: 244 SARLYAANGLQLGQSYELDAIAAVILGGTSFVGGTGSIVGTLVGALIIAVLSNGLVLLGV 303 Query: 320 AQEWQTVVTGVIIILAVYLDILRRRRRA 347 + WQ ++ G++II AV LD RR+ A Sbjct: 304 SDIWQYIIKGLVIIGAVALDSYRRKGSA 331 Lambda K H 0.326 0.139 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 333 Length adjustment: 28 Effective length of query: 319 Effective length of database: 305 Effective search space: 97295 Effective search space used: 97295 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory