Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate RR42_RS32890 RR42_RS32890 ABC transporter permease
Query= uniprot:D8J112 (347 letters) >FitnessBrowser__Cup4G11:RR42_RS32890 Length = 322 Score = 219 bits (558), Expect = 8e-62 Identities = 130/323 (40%), Positives = 199/323 (61%), Gaps = 12/323 (3%) Query: 26 ARLFNPA---ARQKLLAFASLLLMILFFSFASPNFMEVDNLVSILQSTAVNGVLAIACTY 82 A LF P AR +L L+ L + AS F+ + N++++L+ ++ +LA T Sbjct: 4 ATLFPPLSADARSFAYRLFALGLLCLLLAVASDAFLTLGNILNVLRQASLLFLLASGVTL 63 Query: 83 VIITSGIDLSVGTMMTFCAVMAGVVLTNWGMPLPLGIAAAIFFGALSGWISGMVIAKLKV 142 VI+T G+DLSVG + A +A V+ G + LG+ A + GAL G +G+++A L++ Sbjct: 64 VILTGGLDLSVGANVAMSACVAATVMKATGSTM-LGVGAGLGTGALIGLANGLLVAMLRI 122 Query: 143 PPFIATLGMMMLLKGLSLVISGTRPIYFNDTEGFSAIAQDSLIGDLIPSLPIPNAVLILF 202 PPFIAT GM+ +L G++ I+ F AI L G +PIP ++++F Sbjct: 123 PPFIATYGMLWVLHGVTYWFMAGETIH-GFPPAFRAIGSGYLWG-----VPIPVYLMLVF 176 Query: 203 LVAIGASIILNKTVFGRYTFALGSNEEALRLSGVKVDFWKVAVYTFSGAICGIAGLIIAS 262 LVA + + KT +G+ +A+G+N A RLSGV V V VY SGA+ GIA L+ + Sbjct: 177 LVA--GTAMSQKTTYGQEIYAIGANPVAARLSGVPVRRRLVLVYLVSGAMAGIASLVFLA 234 Query: 263 RLNSAQPALGQGYELDAIAAVVIGGTSLSGGTGTILGTIIGAFIMSVLVNGLRIMSVAQE 322 RLNSA+ +G+ L AIAAV+IGGTSL GG G + GT++GA I+++++NG+ +++V+ Sbjct: 235 RLNSAEGDIGEALTLPAIAAVLIGGTSLFGGVGRVSGTLVGAIILTLVLNGMNLLTVSAN 294 Query: 323 WQTVVTGVIIILAVYLDILRRRR 345 WQ +VTGVI++LAV+LD L R+R Sbjct: 295 WQPLVTGVIVVLAVFLDTLSRKR 317 Lambda K H 0.326 0.139 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 322 Length adjustment: 28 Effective length of query: 319 Effective length of database: 294 Effective search space: 93786 Effective search space used: 93786 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory