Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate RR42_RS32895 RR42_RS32895 ABC transporter permease
Query= uniprot:D8J112 (347 letters) >FitnessBrowser__Cup4G11:RR42_RS32895 Length = 318 Score = 188 bits (478), Expect = 1e-52 Identities = 102/297 (34%), Positives = 173/297 (58%), Gaps = 9/297 (3%) Query: 43 LLLMILFFSFASPNFMEVDNLVSILQSTAVNGVLAIACTYVIITSGIDLSVGTMMTFCAV 102 LLL+ L FS P F+ V+NL++I + + ++A+ T +I+T G+DLS+G ++T C V Sbjct: 25 LLLLSLGFSVTGPGFLSVENLLNIGAQSTILLLIALPMTLIIMTEGLDLSMGAVLTLCGV 84 Query: 103 MAGVVLTNWGMPLPLGIAAAIFFGALSGWISGMVIAKLKVPPFIATLGMMMLLKGLSLVI 162 + +V+ LPL + AA+ G G ++G +++ L++PPF+ATLG + + +GL+LV Sbjct: 85 VLAMVMVATES-LPLALGAALLTGLAFGLLNGALVSWLEIPPFVATLGTLGVAQGLALVA 143 Query: 163 SGTRPIYFNDTEGFSAIAQDSLIGDLIPSLPIPNAVLILFLVAIGASIILNKTVFGRYTF 222 + + + E I L+G +P+P + +F +L T FG Y F Sbjct: 144 TDGQSVT-GIGEAIPLIYAGQLLG-----VPLPIWIAAVFYGLF--HWLLYHTRFGAYVF 195 Query: 223 ALGSNEEALRLSGVKVDFWKVAVYTFSGAICGIAGLIIASRLNSAQPALGQGYELDAIAA 282 ALG N EAL+ SGV+++ + +AVY G + G+A L++ +R+N+ P G E DAIAA Sbjct: 196 ALGGNREALKFSGVRINVYLIAVYALGGLMAGVAALLLTARMNAGHPTAAIGLEFDAIAA 255 Query: 283 VVIGGTSLSGGTGTILGTIIGAFIMSVLVNGLRIMSVAQEWQTVVTGVIIILAVYLD 339 V +GGT+ G G + GT++G + VL NGL ++ V Q G+++++ + ++ Sbjct: 256 VAVGGTTFDRGNGWLPGTVLGVLAVGVLRNGLNLVGVPSSVQVAAIGLLVLVVLLIE 312 Lambda K H 0.326 0.139 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 318 Length adjustment: 28 Effective length of query: 319 Effective length of database: 290 Effective search space: 92510 Effective search space used: 92510 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory