Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate RR42_RS27800 RR42_RS27800 ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b21106 (365 letters) >FitnessBrowser__Cup4G11:RR42_RS27800 Length = 357 Score = 219 bits (557), Expect = 1e-61 Identities = 118/226 (52%), Positives = 150/226 (66%), Gaps = 3/226 (1%) Query: 22 IDLEVKDREFIALVGPSGCGKSTTLRMIAGLE-EVSGGAIEIGGRKVNDLPPRARNISMV 80 +DL++ E + L+GPSGCGK+TTLR+IAGLE +GG + G V LP R + MV Sbjct: 26 LDLDIGAGETVVLLGPSGCGKTTTLRIIAGLEFPDAGGVVMFGDNDVTPLPIEQRGVGMV 85 Query: 81 FQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAAAILDLAHLLERRPSQLSGGQRQ 140 FQSYAL+P+MTVAEN+ + L++ A + RV E A++ L ERR QLSGGQRQ Sbjct: 86 FQSYALFPNMTVAENIAYGLRVRRIDAAARRRRVDEMLAMMHLGPFAERRIDQLSGGQRQ 145 Query: 141 RVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKKLHARMQATMIYVTHDQVEAMTL 200 RVA+ RAI QP V L DEPL+ LDAKLR +R +I +L + T +YVTHDQ EAM L Sbjct: 146 RVALARAIAVQPRVLLLDEPLTALDAKLRDALRADINQLLRSLHITAVYVTHDQAEAMAL 205 Query: 201 SDRIVIMRDGHIEQVGTPEDVFRRPATKFVAGFIGSPPMNMEEAVL 246 DRI++M G I Q GTP+ ++R PA FVA FIG+ MN AVL Sbjct: 206 GDRIIVMDRGRIAQTGTPQQIYRAPANAFVADFIGT--MNRLPAVL 249 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 338 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 357 Length adjustment: 29 Effective length of query: 336 Effective length of database: 328 Effective search space: 110208 Effective search space used: 110208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory