Align SDR family oxidoreductase (characterized, see rationale)
to candidate RR42_RS16375 RR42_RS16375 short-chain dehydrogenase
Query= uniprot:A0A4P7ABK7 (254 letters) >FitnessBrowser__Cup4G11:RR42_RS16375 Length = 257 Score = 147 bits (370), Expect = 3e-40 Identities = 101/263 (38%), Positives = 137/263 (52%), Gaps = 28/263 (10%) Query: 7 RLAGKTVLITAAAQGIGRASTELFAREGARVIATDISKTHLE---ELASIAGVETHLLDV 63 RL GK+VL+T A+ GIGRA F REGAR++ DI++T E A + +E H ++ Sbjct: 3 RLEGKSVLVTGASSGIGRAIALRFGREGARLVLADITETVREGGVPTADVLRLEGHEVEF 62 Query: 64 --TD-------DDAIKALVAKVGTVDVLFNCAGYVAAGNILECDDKAWDFSFNLNAKAMF 114 TD D A+ V + G +DVL N A A + E W+ +N +F Sbjct: 63 IRTDVAQESDADAAVAHAVRRYGRLDVLVNDAAISAGKPLTETTIDEWNRVMAVNLTGVF 122 Query: 115 HTIRAVLPGMLAKKA-----GSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADF 169 RA + ML ++ G IVN++S V N AYG SKA VV LT+ +A D+ Sbjct: 123 LMSRAAVSAMLKQEVCREARGRIVNVSSQHGMVCAPRN-VAYGTSKAGVVYLTRQIAVDY 181 Query: 170 VSQGIRCNAICPGTIESPSLNQRISTQAKETGKSEDEVRAAFVARQPMGRIGKAEEVAAL 229 QGI CNA+ PG I + S A E + AR PM R+G+ ++VA+ Sbjct: 182 ADQGIICNAVAPGKIVTGKAGPAASAAALEYSE----------ARTPMPRLGRPDDVASA 231 Query: 230 ALYLASDESNFTTGSIHMIDGGW 252 AL+LASDE+ F TG MIDGGW Sbjct: 232 ALFLASDEATFITGENLMIDGGW 254 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 133 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 257 Length adjustment: 24 Effective length of query: 230 Effective length of database: 233 Effective search space: 53590 Effective search space used: 53590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory