Align 2-keto-3-deoxy-L-fuconate dehydrogenase; EC 1.1.1.- (characterized)
to candidate RR42_RS23690 RR42_RS23690 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase
Query= SwissProt::Q8P3K4 (300 letters) >FitnessBrowser__Cup4G11:RR42_RS23690 Length = 255 Score = 147 bits (370), Expect = 3e-40 Identities = 88/250 (35%), Positives = 129/250 (51%), Gaps = 10/250 (4%) Query: 56 RLQGKRCLITAAGAGIGRESALACARAGAHVIATDIDAAALQALAA----ESDAITTQLL 111 RL+GK ++T G GIG + AR GA V D++ AA Q +A E Sbjct: 3 RLEGKTVIVTGGGGGIGGATCRRFAREGAAVAVLDLNLAAAQQVAQRIREEGGRAEAFQC 62 Query: 112 DVTDAAAITALVAAH----GPFDVLFNCAGYVHQGSILDCDEPAWRRSFSINVDAMYYTC 167 D+TD A++ A VAA GP DVL N AG+ + W R +IN+ + Sbjct: 63 DITDRASVDAAVAATTSQLGPIDVLVNNAGWDVFKPFTKTEPAQWDRLIAINLTGALHMH 122 Query: 168 KAVLPGMLERGRGSIINMSSVASSIKGVPNRFVYGVTKAAVIGLSKAIAADYVAQGVRCN 227 AVLPGM+ER RG I+N++S A+ + G VY K ++ SK IA ++ G+ N Sbjct: 123 HAVLPGMVERKRGRIVNIASDAARV-GSSGEAVYAACKGGLVSFSKTIAREHARHGITVN 181 Query: 228 AICPGTIKTPSLGQRVQALGGDEQAVWKSFTDRQPMGRLGDPREIAQLVVYLASDESSFT 287 +CPG T Q G E+ + ++FT P+GR+G P ++ +V+ ASD+++F Sbjct: 182 VVCPGPTDTALFEDYKQGAGNPEKLI-EAFTRSIPLGRIGQPEDLPGAIVFFASDDAAFV 240 Query: 288 TGQTHIIDGG 297 TGQ + GG Sbjct: 241 TGQVLSVSGG 250 Lambda K H 0.320 0.133 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 255 Length adjustment: 25 Effective length of query: 275 Effective length of database: 230 Effective search space: 63250 Effective search space used: 63250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory