Align Arabinose ABC transporter permease (characterized, see rationale)
to candidate RR42_RS32890 RR42_RS32890 ABC transporter permease
Query= uniprot:A0A161GM94 (322 letters) >FitnessBrowser__Cup4G11:RR42_RS32890 Length = 322 Score = 179 bits (454), Expect = 8e-50 Identities = 100/297 (33%), Positives = 170/297 (57%), Gaps = 3/297 (1%) Query: 28 LAAIGIF-VLCTLMIDNFLSPLNMRGLGLAISTTGIAACTMLYCLASGHFDLSVGSVIAC 86 L A+G+ +L + D FL+ N+ + S + A + + +G DLSVG+ +A Sbjct: 21 LFALGLLCLLLAVASDAFLTLGNILNVLRQASLLFLLASGVTLVILTGGLDLSVGANVAM 80 Query: 87 AGVVAAVVMRDTNSVFLGISAALVMGLIVGLINGIVIAKLRVNALITTLATMQIVRGLAY 146 + VAA VM+ T S LG+ A L G ++GL NG+++A LR+ I T + ++ G+ Y Sbjct: 81 SACVAATVMKATGSTMLGVGAGLGTGALIGLANGLLVAMLRIPPFIATYGMLWVLHGVTY 140 Query: 147 IFANGKAVGVSQESFFVFGNGQMFGVPVPILITIVCFLFFGWLLNY-TTYGRNTMAIGGN 205 F G+ + +F G+G ++GVP+P+ + +V FL G ++ TTYG+ AIG N Sbjct: 141 WFMAGETIHGFPPAFRAIGSGYLWGVPIPVYLMLV-FLVAGTAMSQKTTYGQEIYAIGAN 199 Query: 206 QEAALLAGVNVDRTKIIIFAVHGVIGALAGVILASRMTSGQPMIGQGFELTVISACVLGG 265 AA L+GV V R ++++ V G + +A ++ +R+ S + IG+ L I+A ++GG Sbjct: 200 PVAARLSGVPVRRRLVLVYLVSGAMAGIASLVFLARLNSAEGDIGEALTLPAIAAVLIGG 259 Query: 266 VSLSGGIGMIRHVIAGVLILAIIENAMNLKNIDTFYQYVIRGSILLLAVVIDRLKQR 322 SL GG+G + + G +IL ++ N MNL + +Q ++ G I++LAV +D L ++ Sbjct: 260 TSLFGGVGRVSGTLVGAIILTLVLNGMNLLTVSANWQPLVTGVIVVLAVFLDTLSRK 316 Lambda K H 0.330 0.144 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 322 Length of database: 322 Length adjustment: 28 Effective length of query: 294 Effective length of database: 294 Effective search space: 86436 Effective search space used: 86436 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory