Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate RR42_RS35875 RR42_RS35875 UDP-galactose-4-epimerase
Query= curated2:P55180 (339 letters) >FitnessBrowser__Cup4G11:RR42_RS35875 Length = 339 Score = 415 bits (1066), Expect = e-120 Identities = 202/333 (60%), Positives = 241/333 (72%) Query: 3 ILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAEALNRVKEITGKDLTFYEADLLDR 62 +L+TG GYI SHT V LL +GY ++ LDNL NS+ + R+ +ITG+ F E D+ DR Sbjct: 5 LLLTGATGYIASHTWVALLEAGYHVIGLDNLCNSNRAVVERLAQITGQRPHFVEGDVRDR 64 Query: 63 EAVDSVFAENEIEAVIHFAGLKAVGESVAIPLKYYHNNLTGTFILCEAMEKYGVKKIVFS 122 +D +FAE+ I IHFA LKAVGESV+ PL YY NNL G LC M GVK++VFS Sbjct: 65 ALLDRLFAEHRISGAIHFAALKAVGESVSKPLDYYDNNLNGLLTLCSVMNTAGVKQLVFS 124 Query: 123 SSATVYGVPETSPITEDFPLGATNPYGQTKLMLEQILRDLHTADNEWSVALLRYFNPFGA 182 SSATVYG P T PI EDFPL ATNPYGQTKLM EQILRDL +D W +A LRYFNP GA Sbjct: 125 SSATVYGNPHTVPILEDFPLSATNPYGQTKLMSEQILRDLELSDPAWRIAYLRYFNPVGA 184 Query: 183 HPSGRIGEDPNGIPNNLMPYVAQVAVGKLEQLSVFGNDYPTKDGTGVRDYIHVVDLAEGH 242 H SG IGEDP G+PNNLMPYVAQVA G+ E+L V G DYPT DGTGVRDYIHV DLA GH Sbjct: 185 HESGLIGEDPGGVPNNLMPYVAQVAGGRREKLQVHGGDYPTVDGTGVRDYIHVCDLAAGH 244 Query: 243 VKALEKVLNSTGADAYNLGTGTGYSVLEMVKAFEKVSGKEVPYRFADRRPGDIATCFADP 302 + AL + + NLGTG GYSVLE+V A+++ SG+ VPY DRRPGDIA+C+ADP Sbjct: 245 LAALVYLRDQQQCLTVNLGTGRGYSVLEVVAAYQRASGRPVPYVIGDRRPGDIASCYADP 304 Query: 303 AKAKRELGWEAKRGLEEMCADSWRWQSSNVNGY 335 A A++ +GW A+ ++ MC DSWRWQS N G+ Sbjct: 305 ALAQKLIGWRAQHDIDRMCEDSWRWQSMNPLGF 337 Lambda K H 0.315 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 425 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 339 Length adjustment: 28 Effective length of query: 311 Effective length of database: 311 Effective search space: 96721 Effective search space used: 96721 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate RR42_RS35875 RR42_RS35875 (UDP-galactose-4-epimerase)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.18964.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-133 430.6 0.0 1.9e-133 430.4 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS35875 RR42_RS35875 UDP-galactose-4-epi Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS35875 RR42_RS35875 UDP-galactose-4-epimerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 430.4 0.0 1.9e-133 1.9e-133 2 329 .. 5 334 .. 4 337 .. 0.99 Alignments for each domain: == domain 1 score: 430.4 bits; conditional E-value: 1.9e-133 TIGR01179 2 iLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekit..evklvegdladkekleavlee 68 +L+tG++Gyi sh+ ++lle+g++v+ lDnl+++++ ++++l +it + ++vegd++d++ l+++++e lcl|FitnessBrowser__Cup4G11:RR42_RS35875 5 LLLTGATGYIASHTWVALLEAGYHVIGLDNLCNSNRAVVERLAQITgqRPHFVEGDVRDRALLDRLFAE 73 79*******************************************99999******************* PP TIGR01179 69 ekidaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEes 137 ++i iHfaal+avgEsv++Pl YY+nn+++ l+L+++m++agvk+l+Fsssa+vYg++++vpi E++ lcl|FitnessBrowser__Cup4G11:RR42_RS35875 74 HRISGAIHFAALKAVGESVSKPLDYYDNNLNGLLTLCSVMNTAGVKQLVFSSSATVYGNPHTVPILEDF 142 ********************************************************************* PP TIGR01179 138 plnpinpYGrsklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknat.hliklvaevavg 205 pl+++npYG++klm+E+il+dl+ +d++++++ LRYFn++GA+e+g iGe++ + + +l+++va+va g lcl|FitnessBrowser__Cup4G11:RR42_RS35875 143 PLSATNPYGQTKLMSEQILRDLELSDPAWRIAYLRYFNPVGAHESGLIGEDPGGVPnNLMPYVAQVAGG 211 ********************************************************9************ PP TIGR01179 206 krekleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeggesevynlGagqgfsvkevieavkkv 274 +rekl+++G+dypt DGt+vRDyiHv+Dla++Hlaal +l ++++ + nlG+g+g+sv+ev+ a +++ lcl|FitnessBrowser__Cup4G11:RR42_RS35875 212 RREKLQVHGGDYPTVDGTGVRDYIHVCDLAAGHLAALVYLRDQQQCLTVNLGTGRGYSVLEVVAAYQRA 280 ********************************************************************* PP TIGR01179 275 sgkdikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekklk 329 sg+++++ + drR+GD+as++ad++ +++ +gw++++d ++ +++++w+W++ ++ lcl|FitnessBrowser__Cup4G11:RR42_RS35875 281 SGRPVPYVIGDRRPGDIASCYADPALAQKLIGWRAQHD-IDRMCEDSWRWQSMNP 334 ************************************99.************9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (339 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.85 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory