Align Inner membrane ABC transporter permease protein YjfF (characterized)
to candidate RR42_RS03365 RR42_RS03365 ribose ABC transporter permease
Query= SwissProt::P37772 (331 letters) >FitnessBrowser__Cup4G11:RR42_RS03365 Length = 333 Score = 152 bits (384), Expect = 1e-41 Identities = 104/309 (33%), Positives = 166/309 (53%), Gaps = 18/309 (5%) Query: 4 RNLPLMITIGVFVLGYLYCLTQFPGFASTRVICNILTDNAFLGIIAVGMTFVILSGGIDL 63 R L ++ + + +G+ F G+ + +I + N ++A GMTFVIL+GGIDL Sbjct: 27 RALGMLPVLVLLCIGFSVLTENFAGWQNLSIIAQQASINM---VLAAGMTFVILTGGIDL 83 Query: 64 SVGSVIAFTGVFLAKVIGDFGLSPLLAFPLVLVMGCAFGAFMGLLIDALKIPAFIITLAG 123 SVGS+++ + V +A ++ +L+ P L+ G FG G L+ +K+P FI+TL Sbjct: 84 SVGSILSISAV-VAMLVSLMPQLGMLSVPAALLCGLLFGIVNGALVAFMKLPPFIVTLGT 142 Query: 124 MFFLRGVSYLVSEESIPINHPIYDTLSSLAWKIPGGGRLSAMGLLML---AVVVIGIFLA 180 + +RG++ LV +S N I + G G + + L++ AVV + F+ Sbjct: 143 LTAVRGLARLVGNDSTIYNPDI-------GFAFIGNGEVLGVPWLVIIAFAVVAVSWFVL 195 Query: 181 HRTRFGNQVYAIGGNATSANLMGISTRSTTIRIYMLSTGLATLAGIVFS--IYTQAGYAL 238 RT G Q+YA+GGNA +A L GI + +Y +S LA L G++ S +Y G L Sbjct: 196 RRTVLGLQIYAVGGNAEAARLSGIKVWVVLLFVYAVSGLLAGLGGVMSSARLYAANGLQL 255 Query: 239 AGVGVELDAIASVVIGGTLLSGGVGTVLGTLFGVAIQGLIQTYINFDGTLSSWWTKIAIG 298 G ELDAIA+V++GGT GG G+++GTL G I ++ + G +S W I G Sbjct: 256 -GQSYELDAIAAVILGGTSFVGGTGSIVGTLVGALIIAVLSNGLVLLG-VSDIWQYIIKG 313 Query: 299 ILLFIFIAL 307 +++ +AL Sbjct: 314 LVIIGAVAL 322 Lambda K H 0.329 0.145 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 333 Length adjustment: 28 Effective length of query: 303 Effective length of database: 305 Effective search space: 92415 Effective search space used: 92415 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory