Align Galactofuranose transporter permease protein YtfT (characterized)
to candidate RR42_RS03365 RR42_RS03365 ribose ABC transporter permease
Query= SwissProt::P39328 (341 letters) >FitnessBrowser__Cup4G11:RR42_RS03365 Length = 333 Score = 170 bits (431), Expect = 4e-47 Identities = 98/271 (36%), Positives = 166/271 (61%), Gaps = 4/271 (1%) Query: 59 ILNRAAPVALLAIGMTLVIATGGIDLSVGAVMAIAGATTAAMTVAGFSLPIVLLSALGTG 118 I +A+ +LA GMT VI TGGIDLSVG++++I+ +++ + + +AL G Sbjct: 58 IAQQASINMVLAAGMTFVILTGGIDLSVGSILSISAVVAMLVSLMPQLGMLSVPAALLCG 117 Query: 119 ILAGLWNGILVAILKIQPFVATLILMVAGRGVAQLITAGQIVTFNSPDL--SWFGSGSLL 176 +L G+ NG LVA +K+ PF+ TL + A RG+A+L+ G T +PD+ ++ G+G +L Sbjct: 118 LLFGIVNGALVAFMKLPPFIVTLGTLTAVRGLARLV--GNDSTIYNPDIGFAFIGNGEVL 175 Query: 177 FLPTPVIIAVLTLILFWLLTRKTALGMFIEAVGINIRAAKNAGVNTRIIVMLTYVLSGLC 236 +P VIIA + + W + R+T LG+ I AVG N AA+ +G+ ++++ Y +SGL Sbjct: 176 GVPWLVIIAFAVVAVSWFVLRRTVLGLQIYAVGGNAEAARLSGIKVWVVLLFVYAVSGLL 235 Query: 237 AAIAGIIVAADIRGADANNAGLWLELDAILAVVIGGGSLMGGRFNLLLSVVGALIIQGMN 296 A + G++ +A + A+ G ELDAI AV++GG S +GG +++ ++VGALII ++ Sbjct: 236 AGLGGVMSSARLYAANGLQLGQSYELDAIAAVILGGTSFVGGTGSIVGTLVGALIIAVLS 295 Query: 297 TGILLSGFPPEMNQVVKAVVVLCVLIVQSQR 327 G++L G ++K +V++ + + S R Sbjct: 296 NGLVLLGVSDIWQYIIKGLVIIGAVALDSYR 326 Lambda K H 0.327 0.142 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 333 Length adjustment: 28 Effective length of query: 313 Effective length of database: 305 Effective search space: 95465 Effective search space used: 95465 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory