Align Galactofuranose transporter permease protein YtfT (characterized)
to candidate RR42_RS32895 RR42_RS32895 ABC transporter permease
Query= SwissProt::P39328 (341 letters) >FitnessBrowser__Cup4G11:RR42_RS32895 Length = 318 Score = 156 bits (395), Expect = 6e-43 Identities = 113/322 (35%), Positives = 173/322 (53%), Gaps = 11/322 (3%) Query: 6 LPDTTTPKRRFRWPTG-MPQLVALLLVLLVD-SLVAPHFWQVVLQDGRLFGSPIDILNRA 63 +PDT R G +P V +LL+L + S+ P F V + ++I ++ Sbjct: 1 MPDTNALPRPLGLSIGKVPGSVWVLLLLSLGFSVTGPGFLSVE--------NLLNIGAQS 52 Query: 64 APVALLAIGMTLVIATGGIDLSVGAVMAIAGATTAAMTVAGFSLPIVLLSALGTGILAGL 123 + L+A+ MTL+I T G+DLS+GAV+ + G A + VA SLP+ L +AL TG+ GL Sbjct: 53 TILLLIALPMTLIIMTEGLDLSMGAVLTLCGVVLAMVMVATESLPLALGAALLTGLAFGL 112 Query: 124 WNGILVAILKIQPFVATLILMVAGRGVAQLITAGQIVTFNSPDLSWFGSGSLLFLPTPVI 183 NG LV+ L+I PFVATL + +G+A + T GQ VT + +G LL +P P+ Sbjct: 113 LNGALVSWLEIPPFVATLGTLGVAQGLALVATDGQSVTGIGEAIPLIYAGQLLGVPLPIW 172 Query: 184 IAVLTLILFWLLTRKTALGMFIEAVGINIRAAKNAGVNTRIIVMLTYVLSGLCAAIAGII 243 IA + LF L T G ++ A+G N A K +GV + ++ Y L GL A +A ++ Sbjct: 173 IAAVFYGLFHWLLYHTRFGAYVFALGGNREALKFSGVRINVYLIAVYALGGLMAGVAALL 232 Query: 244 VAADIRGADANNAGLWLELDAILAVVIGGGSLMGGRFNLLLSVVGALIIQGMNTGILLSG 303 + A + A A + LE DAI AV +GG + G L +V+G L + + G+ L G Sbjct: 233 LTARM-NAGHPTAAIGLEFDAIAAVAVGGTTFDRGNGWLPGTVLGVLAVGVLRNGLNLVG 291 Query: 304 FPPEMNQVVKAVVVLCVLIVQS 325 P + ++VL VL+++S Sbjct: 292 VPSSVQVAAIGLLVLVVLLIES 313 Lambda K H 0.327 0.142 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 318 Length adjustment: 28 Effective length of query: 313 Effective length of database: 290 Effective search space: 90770 Effective search space used: 90770 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory