Align Probable galactarate dehydratase (L-threo-forming); GalcD; EC 4.2.1.42 (uncharacterized)
to candidate RR42_RS34975 RR42_RS34975 galactarate dehydratase
Query= curated2:P42240 (510 letters) >FitnessBrowser__Cup4G11:RR42_RS34975 Length = 515 Score = 311 bits (798), Expect = 3e-89 Identities = 191/499 (38%), Positives = 270/499 (54%), Gaps = 27/499 (5%) Query: 8 NQAPLYIKVHEIDNTAIIVNDGGLPKGTVFSC-GLVLEEDVPQGHKVALTDLNQGDEIVR 66 + AP I++H D+ I L GTV + G+ + VP GHK+A+ + G + R Sbjct: 4 DNAPKVIRIHPADDIVIACRQ--LVPGTVIAAEGVSVASLVPPGHKLAVRAIAAGAPVRR 61 Query: 67 YGEVIGFADETIKRGSWIREALVRMPA----PPALDDLPLANRVPQPRPPLEGYTFEGYR 122 Y ++IGFA + I G + + M A D V P +F+G + Sbjct: 62 YNQIIGFARQPIAPGQHVHTHNLAMGEFTREYAAGADARATEYVDAPA------SFDGIK 115 Query: 123 NADGSAGTKNILGITTSVQCVV----GVLDYAVKRIKEELLPKYPNVDDVVPLHHQYGCG 178 ADGS T+N +GI TSV C + D+ + ++ E L +PNVD VV L H GC Sbjct: 116 RADGSVATRNYIGILTSVNCSATVARAIADHFRRELRPEALAAFPNVDGVVALTHGAGCA 175 Query: 179 VAINAPDAVIPIRTIQNLAKHPNFGGEVMVIGLGCEKLLPERIASENDD---------DI 229 + + RT+ A+HPNF V+V+GLGCE + + +E D Sbjct: 176 TDSEGENLRVLRRTLAGYARHPNFAA-VLVVGLGCEANQIDGLLAEGDLAGMAGGPRLHA 234 Query: 230 LSLQDHRGFAAMIQSILEMAEERLIRLNSRTRVSCPVSDLVIGLQCGGSDAFSGVTANPA 289 ++QD G A + + + ++ L N +R + P S + +GLQCGGSD +SG+TANPA Sbjct: 235 FNIQDSGGTAGAVARGVAIVQDLLADANRVSRQAVPASHITVGLQCGGSDGYSGLTANPA 294 Query: 290 VGYAADLLVRAGATVLFSEVTEVRDAIHLLTPRAVSEEVGQSLIKEMKWYDSYLRRGDAD 349 +G A DLLVR G + SE E+ A HLLT RA S V L++ ++W++ Y R Sbjct: 295 LGAAVDLLVRHGGGAILSETPEIYGAEHLLTRRAASPAVAARLLERIRWWEDYCARNHGS 354 Query: 350 RSANPSPGNKKGGLSNVVEKALGSVAKSGTSPISGVLGPGERAKQKGLLFAATPASDFVC 409 NPS GNK GGL+ ++EK+LG+VAKSGT+ + V + + +GL+F TP D V Sbjct: 355 MDNNPSAGNKAGGLTTILEKSLGAVAKSGTTNLVEVYEFAQPVRARGLVFMDTPGYDPVS 414 Query: 410 GTLQLAAGMNLQVFTTGRGTPYGLAAAPVLKVSTRHSLSEHWADLIDINAGRIATGEASI 469 T Q+A G NL FTTGRG+ YG A +P LK++T +L + AD IDIN G I G ASI Sbjct: 415 ATGQVAGGANLICFTTGRGSAYGCAPSPSLKLATNSALWQRQADDIDINCGDIVDGGASI 474 Query: 470 EDVGWEIFRTILDVASGRK 488 G +IFR +L+ ASGRK Sbjct: 475 AHKGEQIFRRMLETASGRK 493 Lambda K H 0.318 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 685 Number of extensions: 35 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 510 Length of database: 515 Length adjustment: 35 Effective length of query: 475 Effective length of database: 480 Effective search space: 228000 Effective search space used: 228000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory