Align 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41) (characterized)
to candidate RR42_RS29080 RR42_RS29080 5-dehydro-4-deoxyglucarate dehydratase
Query= reanno::BFirm:BPHYT_RS24155 (305 letters) >FitnessBrowser__Cup4G11:RR42_RS29080 Length = 304 Score = 518 bits (1335), Expect = e-152 Identities = 257/305 (84%), Positives = 279/305 (91%), Gaps = 1/305 (0%) Query: 1 MTTPQELKQIVSEGLLSFPVTDFDEQGDFRADTYAERLEWLAPYGASALFVAGGTGEFFS 60 MTTPQELKQIVSEGLLSFPVTDFD QG+FR +TY ERLEWLAPYGA+ALF AGGTGEFFS Sbjct: 1 MTTPQELKQIVSEGLLSFPVTDFDAQGNFRPETYVERLEWLAPYGATALFAAGGTGEFFS 60 Query: 61 LTHNDYSNVVKTATEVCKGKVPILAGAGGPTRVAIAYAQEAERHGANGILLMPHYLTEAC 120 LT +DY+NV++TA E C GKVPILAGAGGPTR+AIAYA+EA+R GA GILL+PHYLTEAC Sbjct: 61 LTPDDYTNVIRTAVETCAGKVPILAGAGGPTRMAIAYAKEAQRLGAKGILLLPHYLTEAC 120 Query: 121 QEGIAAHAEEVCKSVPNMGVIIYNRANSKLNADMLEGLAERCPNLIGFKDGVGEIENMVS 180 Q+GIA H EEVCKSV ++GVI+YNR NS++NADMLE LA+RCPNLIGFKDGVGEIE MV Sbjct: 121 QDGIANHIEEVCKSV-HIGVIVYNRGNSRINADMLERLADRCPNLIGFKDGVGEIEGMVR 179 Query: 181 IRRRLGDRFSYLGGLPTAEVYAAAYKALGVPVYSSAVFNFIPKTAMDFYRAIAADDHATV 240 IRR+LGDR SYLGGLPTAEVYAAAYKALGVPVYSSAVFNFIPKTAMDFYRAIAADDHAT Sbjct: 180 IRRKLGDRLSYLGGLPTAEVYAAAYKALGVPVYSSAVFNFIPKTAMDFYRAIAADDHATT 239 Query: 241 GKLIDEFFLPYLAIRNRRAGYAVSIVKAGAKLVGHSAGPVRAPLTDLTEEEMGKLDALIK 300 +LIDEFFLPYL IRNRRAGYAVSIVKAGAKLVGH AGPVRAPLTDL E+E+ LDALIK Sbjct: 240 NRLIDEFFLPYLDIRNRRAGYAVSIVKAGAKLVGHDAGPVRAPLTDLDEQELAMLDALIK 299 Query: 301 TLGPQ 305 LGPQ Sbjct: 300 KLGPQ 304 Lambda K H 0.319 0.136 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 429 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 304 Length adjustment: 27 Effective length of query: 278 Effective length of database: 277 Effective search space: 77006 Effective search space used: 77006 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate RR42_RS29080 RR42_RS29080 (5-dehydro-4-deoxyglucarate dehydratase)
to HMM TIGR03249 (kdgD: 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03249.hmm # target sequence database: /tmp/gapView.2081010.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03249 [M=299] Accession: TIGR03249 Description: KdgD: 5-dehydro-4-deoxyglucarate dehydratase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-139 450.6 0.0 1.3e-139 450.4 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS29080 RR42_RS29080 5-dehydro-4-deoxygl Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS29080 RR42_RS29080 5-dehydro-4-deoxyglucarate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 450.4 0.0 1.3e-139 1.3e-139 1 298 [. 4 301 .. 4 302 .. 1.00 Alignments for each domain: == domain 1 score: 450.4 bits; conditional E-value: 1.3e-139 TIGR03249 1 pqelkkkigsGllsfPvtpfdadgsldeaalrenieflldedlealfvagGtGeffsltkaeveqvvev 69 pqelk+ +++GllsfPvt+fda+g+++++++ e++e+l+++++ alf+agGtGeffslt+ ++ +v++ lcl|FitnessBrowser__Cup4G11:RR42_RS29080 4 PQELKQIVSEGLLSFPVTDFDAQGNFRPETYVERLEWLAPYGATALFAAGGTGEFFSLTPDDYTNVIRT 72 89******************************************************************* PP TIGR03249 70 aveaakgkvPvlagvGgnlsvaieiaraaekkGadGllllPpylieaeqeGlaayvkaviesvdlgviv 138 ave+++gkvP+lag+Gg +++ai +a++a++ Ga+G+lllP+yl+ea q+G+a+++++v++sv++gviv lcl|FitnessBrowser__Cup4G11:RR42_RS29080 73 AVETCAGKVPILAGAGGPTRMAIAYAKEAQRLGAKGILLLPHYLTEACQDGIANHIEEVCKSVHIGVIV 141 ********************************************************************* PP TIGR03249 139 yqrdnavleadtlerlaerlpnlvGfkdGiGdiekvieitqklGdrllylgGlPtaevtalaylalGvt 207 y+r n+ ++ad+lerla+r+pnl+GfkdG+G+ie +++i++klGdrl ylgGlPtaev+a+ay+alGv lcl|FitnessBrowser__Cup4G11:RR42_RS29080 142 YNRGNSRINADMLERLADRCPNLIGFKDGVGEIEGMVRIRRKLGDRLSYLGGLPTAEVYAAAYKALGVP 210 ********************************************************************* PP TIGR03249 208 syssaifnfiPkiarkfyealrkgdeatvkeilkevilPiveirnrkkGyavslikaGlevvGrdvgpv 276 +yssa+fnfiPk+a++fy+a++ +d+at +++++e++lP++ irnr++Gyavs++kaG+++vG+d+gpv lcl|FitnessBrowser__Cup4G11:RR42_RS29080 211 VYSSAVFNFIPKTAMDFYRAIAADDHATTNRLIDEFFLPYLDIRNRRAGYAVSIVKAGAKLVGHDAGPV 279 ********************************************************************* PP TIGR03249 277 raPlvdlekeelaeleellkka 298 raPl+dl+++ela l++l+kk+ lcl|FitnessBrowser__Cup4G11:RR42_RS29080 280 RAPLTDLDEQELAMLDALIKKL 301 ********************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (299 nodes) Target sequences: 1 (304 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 20.12 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory