Align Altronate dehydratase; EC 4.2.1.7; D-altronate hydro-lyase (uncharacterized)
to candidate RR42_RS00275 RR42_RS00275 galactarate dehydratase
Query= curated2:O34673 (497 letters) >FitnessBrowser__Cup4G11:RR42_RS00275 Length = 522 Score = 266 bits (681), Expect = 1e-75 Identities = 160/495 (32%), Positives = 264/495 (53%), Gaps = 20/495 (4%) Query: 5 IKIHKQDNVLLALRDIQKGERLHAYGVSIEVKDDIKRGHKIALQSIKENDSIVKYGFPIG 64 I++H D+V++A + G + GV+ V + GHKIA ++I +++ +YG IG Sbjct: 20 IRLHPDDDVVIARDQMVAGTPIADEGVT--VIGLVPPGHKIATRAIANGEAVRRYGQIIG 77 Query: 65 HASQDISIGEHIHVHNTKTNLSDIQLYSYTPRFDENPYSNENRTFKGFRRENGDAGVRNE 124 ASQDI G+H+H HN + Y+++ + + TF G +R +G RN Sbjct: 78 FASQDIRAGQHVHTHNLAMG-DFTRDYAFSAEARVVRPAAQPATFDGIKRADGGVATRNY 136 Query: 125 LWIVPTVGCVNGIAEKMLQRFVRETGDIAP--------FDNVLVLKHQYGCS--QLGDDH 174 + I+ +V C +A + F R DI P D V+ L H GC+ G+ Sbjct: 137 IGILTSVNCSATVARAIADHFRR---DIHPQALAAYPNVDGVVALTHGVGCAVDPQGEGL 193 Query: 175 ENTKQILLNAIRHPNAGGVLVLGLGCENNELARM---KEALQDVNLKRVKFLESQSVTDE 231 ++ L HPN VLV+GLGCE N+++ + + L+ ++ T Sbjct: 194 AVLQRTLGGYACHPNFASVLVIGLGCETNQISALLATQGLAHSDRLQTFTIQDTGGTTKT 253 Query: 232 MEAGVALLKEIHEAAKGDKREDIPLSELKIGLKCGGSDGFSGITANPLLGRFSDYLIAQG 291 + G+ L+K + A +R+ +P L +GL+CGGSDG+SGI+ANP+LG D L+ G Sbjct: 254 IAHGIELIKAMLPKANAVERQPVPAHHLVVGLQCGGSDGYSGISANPVLGAAVDLLVRNG 313 Query: 292 GSTVLTEVPEMFGAETILMQRAANEEVFHKIVDLINDFKQYFIKHDQPVYENPSPGNKAG 351 G+ +L+E PE++GAE +L +RA E+ K+V I ++ Y +H + NPS GNKAG Sbjct: 314 GTAILSETPEIYGAEHLLTRRAQTPEIGRKLVARIRWWEAYCERHGASMDNNPSAGNKAG 373 Query: 352 GISTLEDKSLGCTQKAGISPVTDVLKYGEVLKTKGLTLLSAPGNDLIASSALAAAGCQIV 411 G++T+ +KSLG K G + + +V +Y + ++ +GL + PG D I+++ A G ++ Sbjct: 374 GLTTVLEKSLGGIAKGGSTNLAEVYEYAQPVRVRGLVFMDTPGYDPISATGQVAGGANLI 433 Query: 412 LFTTGRGTPFGTF-VPTVKVATNTELYEAKPHWIDFNAGLLAEDDVHEEYVLREFIHYMI 470 FTTGRG+ +G P+VK+ATNT L++ + +D N G + + + M+ Sbjct: 434 CFTTGRGSAYGCAPSPSVKLATNTALWQRQSDDMDLNCGTVLDGSATIAELGAALFELML 493 Query: 471 EVASGQLVNHEKNDF 485 + ASG+ E + + Sbjct: 494 DTASGKRSRSELHGY 508 Lambda K H 0.317 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 597 Number of extensions: 29 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 522 Length adjustment: 34 Effective length of query: 463 Effective length of database: 488 Effective search space: 225944 Effective search space used: 225944 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory