Align Senescence marker protein-30 family protein (characterized, see rationale)
to candidate RR42_RS33665 RR42_RS33665 gluconolactonase
Query= uniprot:Q888H2 (294 letters) >FitnessBrowser__Cup4G11:RR42_RS33665 Length = 300 Score = 382 bits (980), Expect = e-111 Identities = 179/292 (61%), Positives = 219/292 (75%), Gaps = 4/292 (1%) Query: 4 ELIVDAQNATGESPVWSVREQALYWVDIPNGELHRWDSSQDRTRSWKAPQMLACIAADSR 63 +LI D +NA GESP W + Q LYW DIP L W ++ R+W+ P+M CIA S Sbjct: 8 DLIADVRNAVGESPFWDTQTQCLYWSDIPARTLFEWRAANAAIRTWELPEMAGCIAPASA 67 Query: 64 GGWIAGMENGLYHLQPCDDGSLISTLLASVEHAQTGMRFNDGRCDRQGRFWAGTMLMDMA 123 GG++AGM++GL+HLQP DGS+ S LASV H MRFNDGRCDRQGRFWAGTM +DM Sbjct: 68 GGFVAGMQSGLFHLQPQPDGSMASRRLASVAHPAPSMRFNDGRCDRQGRFWAGTMHLDMH 127 Query: 124 AGAVVGALYRYSAGQKTLEAQLKDLIVPNGLAFSPDGKTMYLSDSHPAVQKIWAFDYDTD 183 +G++YR+ A + L+ Q++ LIVPNG+A+SPDG+TMYLSDSHP VQ IWAFDYD Sbjct: 128 PAQSIGSVYRFDA--RGLQQQIEGLIVPNGMAWSPDGRTMYLSDSHPDVQAIWAFDYDAA 185 Query: 184 SGTPHDRRLFVDMNNYLGRPDGAAIDADGCYWICGNDAGLVHRFTPNGKLDRSLVVPVKK 243 +G RRL++DM Y GRPDGAA+D DGCYWICGNDAG+VHRFTP G+LDRS+ +PVKK Sbjct: 186 NGVASRRRLWIDMRQYPGRPDGAAVDVDGCYWICGNDAGVVHRFTPEGRLDRSIALPVKK 245 Query: 244 PAMCAFGGPNLDTLFVTSIRP--GGDLSDQPLAGGVFALRPGVKGLEEPVFQ 293 PAMCAFGG ++ TLFVTSIRP ++QPLAGGVFA+RPGV G+ E FQ Sbjct: 246 PAMCAFGGADMKTLFVTSIRPADASVQAEQPLAGGVFAVRPGVAGIAERAFQ 297 Lambda K H 0.320 0.138 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 445 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 300 Length adjustment: 26 Effective length of query: 268 Effective length of database: 274 Effective search space: 73432 Effective search space used: 73432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory