Align phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating) (EC 1.1.1.343) (characterized)
to candidate RR42_RS27085 RR42_RS27085 hypothetical protein
Query= BRENDA::G5EBD7 (332 letters) >FitnessBrowser__Cup4G11:RR42_RS27085 Length = 322 Score = 406 bits (1044), Expect = e-118 Identities = 198/330 (60%), Positives = 249/330 (75%), Gaps = 8/330 (2%) Query: 1 MRIGIIGLGRMGGNIAVRLTRHGHDVVVHDRTSEVTTSVVGRCEAGRATPADTLADMAKL 60 M++GIIGLGRMG NIA RL R H+VVV++R+++ ++ G + + ++A Sbjct: 1 MQLGIIGLGRMGANIARRLLRAQHEVVVYNRSADKVQALAADGAVGVTSIEALVGELAA- 59 Query: 61 LEGDEHRVVWVMLPAGAITEDCVQQLGGLLGRGDIIIDGGNTYYKDDVRRSAELAEKGIS 120 R +WVMLPAG TE + L LL GD+IIDGGNT+YKDD+RR+ ELA + + Sbjct: 60 -----PRAIWVMLPAGDTTEQMIATLADLLEPGDVIIDGGNTFYKDDIRRAGELAARQLH 114 Query: 121 YVDVGTSGGVWGLERGYCMMFGGTKETAEYIDPILSALAPGIGDVPRTPGRDEAGHDPRA 180 YVDVGTSGGVWGLERGYC+M GG +E +DP+ LAPG GD+PRTPGR+ A + RA Sbjct: 115 YVDVGTSGGVWGLERGYCLMIGGRQEVVGRLDPLFDTLAPGYGDIPRTPGRNPA--NDRA 172 Query: 181 EQGYLHCGPAGSGHFVKMVHNGIEYGMMQAFAEGFDIMKSKNSPILAEKDRFELNMGDIA 240 E+GY+H GPAG+GHFVKMVHNGIEYG+MQA+AEGFDI+K+K + L E +RF L++ DIA Sbjct: 173 ERGYIHAGPAGAGHFVKMVHNGIEYGLMQAYAEGFDILKTKAAESLPEAERFALDLADIA 232 Query: 241 EVWRRGSVVSSWLLDLTAEALTRSETLNEFSGEVADSGEGRWTIEAAIEEDVPAPVMTAA 300 EVWRRGSVVSSWLLDLTA+AL L+ FSGEVADSGEGRWTI+AA+E+ VP PV+ +A Sbjct: 233 EVWRRGSVVSSWLLDLTAQALASDVKLSRFSGEVADSGEGRWTIDAAVEQAVPVPVLASA 292 Query: 301 LFTRFRSRSGNNFAEKILSAQRFGFGGHVE 330 LF RFRSR + + E++LSA RFGFGGHVE Sbjct: 293 LFARFRSRQDHTYGERLLSAMRFGFGGHVE 322 Lambda K H 0.318 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 322 Length adjustment: 28 Effective length of query: 304 Effective length of database: 294 Effective search space: 89376 Effective search space used: 89376 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate RR42_RS27085 RR42_RS27085 (hypothetical protein)
to HMM TIGR00872 (gnd: 6-phosphogluconate dehydrogenase (decarboxylating) (EC 1.1.1.44))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00872.hmm # target sequence database: /tmp/gapView.30871.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00872 [M=299] Accession: TIGR00872 Description: gnd_rel: 6-phosphogluconate dehydrogenase (decarboxylating) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-119 384.5 0.0 1.9e-119 384.3 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS27085 RR42_RS27085 hypothetical protei Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS27085 RR42_RS27085 hypothetical protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 384.3 0.0 1.9e-119 1.9e-119 1 294 [. 1 321 [. 1 322 [] 0.98 Alignments for each domain: == domain 1 score: 384.3 bits; conditional E-value: 1.9e-119 TIGR00872 1 mklgliGlGrmGaniakrlakrghevvgydrdqdaveelkedraegvanlkellkrlsaprvvwvmvpa 69 m+lg+iGlGrmGania+rl +hevv+y+r+ d v++l++d+a+gv++++ l+ +l apr +wvm+pa lcl|FitnessBrowser__Cup4G11:RR42_RS27085 1 MQLGIIGLGRMGANIARRLLRAQHEVVVYNRSADKVQALAADGAVGVTSIEALVGELAAPRAIWVMLPA 69 9******************************************************************** PP TIGR00872 70 g.ivdavleelapllekGdividgGnsyykdslrrekelkekgihlldvGtsGGvlGkerGyclmiGGd 137 g +++++ la+lle Gd++idgGn++ykd++rr el +++h++dvGtsGGv+G erGyclmiGG lcl|FitnessBrowser__Cup4G11:RR42_RS27085 70 GdTTEQMIATLADLLEPGDVIIDGGNTFYKDDIRRAGELAARQLHYVDVGTSGGVWGLERGYCLMIGGR 138 *88999*************************************************************** PP TIGR00872 138 eeafkkaeplfk.................dvaveekGylylGeaGsGhfvkmvhnGieyGlmaalaeGl 189 +e+ + +plf e+Gy+++G+aG+GhfvkmvhnGieyGlm+a aeG+ lcl|FitnessBrowser__Cup4G11:RR42_RS27085 139 QEVVGRLDPLFDtlapgygdiprtpgrnpANDRAERGYIHAGPAGAGHFVKMVHNGIEYGLMQAYAEGF 207 ***************************875556789********************************* PP TIGR00872 190 evlkns.........qfdfdleevarvyrrGsvirsflldltakaleesadleeveGrvedsGeGrwtv 249 ++lk +f dl ++a+v+rrGsv+ s+lldlta+al+ + +l ++G v dsGeGrwt+ lcl|FitnessBrowser__Cup4G11:RR42_RS27085 208 DILKTKaaeslpeaeRFALDLADIAEVWRRGSVVSSWLLDLTAQALASDVKLSRFSGEVADSGEGRWTI 276 ***98889************************************************************* PP TIGR00872 250 kaavdlgvpapvlatslqerfasrekddfankvlaalrkefGgha 294 aav++ vp+pvla +l rf+sr++ ++ ++ l+a+r fGgh lcl|FitnessBrowser__Cup4G11:RR42_RS27085 277 DAAVEQAVPVPVLASALFARFRSRQDHTYGERLLSAMRFGFGGHV 321 ********************************************6 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (299 nodes) Target sequences: 1 (322 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.41 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory