Align ABC transporter for D-Glucosamine, putative ATPase component (characterized)
to candidate RR42_RS09480 RR42_RS09480 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_00465 (263 letters) >FitnessBrowser__Cup4G11:RR42_RS09480 Length = 244 Score = 243 bits (619), Expect = 4e-69 Identities = 122/247 (49%), Positives = 168/247 (68%), Gaps = 10/247 (4%) Query: 12 PLLDIRGLRKQYGPLEVLKGVDLSMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQIV 71 P+++ +G+ K YGP+EVLKGV +++ G VV +IG SGSGK+T+LRC+N LE G I Sbjct: 2 PIVEAQGVHKSYGPVEVLKGVSFAIEPGQVVAIIGRSGSGKSTMLRCLNGLETINAGNIT 61 Query: 72 LDGESIGYDDIDGKRVRHPEKLIARHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKKLP 131 + G + +D K + R GM FQ +NLFPHLT +N+ L VKK+ Sbjct: 62 VAGHKLDHD----------RKRLLDLRRDVGMVFQSYNLFPHLTVGENIALAPAIVKKMA 111 Query: 132 KDEAVALAEKWLERVGLLERRDHFPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSALDP 191 D+ + ++ L +VGL +++D +P QLSGGQQQRVAIAR++AM P +MLFDEVTSALDP Sbjct: 112 TDKIDGIVDQVLAQVGLQDKKDCYPEQLSGGQQQRVAIARSLAMEPKVMLFDEVTSALDP 171 Query: 192 ELVGEVLNVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFERPQS 251 EL EVL V++ LA GMTM+LVTHEM FA ++ +FM+QG++ E GP K LF +P++ Sbjct: 172 ELTAEVLRVMENLAASGMTMVLVTHEMEFARRMAHTTIFMHQGKVHEAGPSKALFAQPRT 231 Query: 252 PRLAEFL 258 P L +FL Sbjct: 232 PELQQFL 238 Lambda K H 0.320 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 244 Length adjustment: 24 Effective length of query: 239 Effective length of database: 220 Effective search space: 52580 Effective search space used: 52580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory