Align ABC transporter for D-Glucosamine, putative ATPase component (characterized)
to candidate RR42_RS27115 RR42_RS27115 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_00465 (263 letters) >FitnessBrowser__Cup4G11:RR42_RS27115 Length = 242 Score = 246 bits (629), Expect = 2e-70 Identities = 126/246 (51%), Positives = 171/246 (69%), Gaps = 10/246 (4%) Query: 13 LLDIRGLRKQYGPLEVLKGVDLSMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQIVL 72 L+ I ++K++G EVLKG+DL ++ G V+ +IG SGSGK+TLLRC+N LE G I + Sbjct: 3 LIAIENVKKRFGANEVLKGIDLKVEAGEVIAIIGKSGSGKSTLLRCINGLESIDEGNITV 62 Query: 73 DGESIGYDDIDGKRVRHPEKLIARHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKKLPK 132 G +G +++ + +R GM FQQFNLFPHL+A +NV L + + Sbjct: 63 AGAKLGSSELELRALRRK----------VGMIFQQFNLFPHLSAGRNVMLAPTVAAGVKE 112 Query: 133 DEAVALAEKWLERVGLLERRDHFPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSALDPE 192 EA+ A + L +V L E+ D +P QLSGGQQQRVAIARA+AM P +L DE+TSALDPE Sbjct: 113 PEALTRARECLAKVALAEKFDSYPDQLSGGQQQRVAIARALAMQPRALLCDEITSALDPE 172 Query: 193 LVGEVLNVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFERPQSP 252 LV EVLNV++ LA +GMT+L+VTHEMRFA EV +++VFM+QGR+ E GPP++LF P +P Sbjct: 173 LVVEVLNVVRQLAREGMTLLMVTHEMRFAREVCNRVVFMHQGRVHEIGPPEQLFSHPATP 232 Query: 253 RLAEFL 258 L +FL Sbjct: 233 ELQQFL 238 Lambda K H 0.320 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 242 Length adjustment: 24 Effective length of query: 239 Effective length of database: 218 Effective search space: 52102 Effective search space used: 52102 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory