Align NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized)
to candidate RR42_RS18605 RR42_RS18605 sugar ABC transporter permease
Query= TCDB::Q8RJU8 (307 letters) >FitnessBrowser__Cup4G11:RR42_RS18605 Length = 295 Score = 132 bits (332), Expect = 1e-35 Identities = 79/266 (29%), Positives = 132/266 (49%), Gaps = 8/266 (3%) Query: 46 LVLWAFMVVLPLLWAVMTSFKDDASIF---GSP-WSLPDKLHFDNWSRAWTEAHMGDYFL 101 L ++ F+++ P W +T+FK D + +P W + F ++ + + ++ L Sbjct: 33 LGIFVFVLLFPFYWMAITAFKPDGELLMRSANPFWVMAPT--FAHFKKLLFDTPYPEWLL 90 Query: 102 NTVLVVGGSLIGTLVLGSMAAYVLARFDFPGNRFIYYLFIGGMSFPIMLALVPLFYVVNN 161 NTV+V S +L +AAY + R F G + + P + +PL +V Sbjct: 91 NTVIVSTISTFASLAASVLAAYAIERLRFQGAKQVGLAVFLAYLIPPSILFIPLASIVFQ 150 Query: 162 MGLLNTLHGLILVYIAYSLPFTVFFLTAFFRTLPSSVAEAAFVDGASHTRTFFQIMLPMA 221 +GL +T LIL Y + +PF + L +FR++P + E A +DGA+ +I+LP+A Sbjct: 151 LGLFDTRWALILTYPTFLIPFCTWLLMGYFRSIPYELEECALIDGATRWEILVKIILPLA 210 Query: 222 KPGLISVGIFNFLGQWNQYMLPTVLNTDPDKRVLTQGLVQLAVSQGYKGDWSGLFAGLVM 281 PGLIS GIF F WN+++ + + + + G+V + +G W L AG ++ Sbjct: 211 VPGLISAGIFAFTLSWNEFIYALTFISSSEVKTVPVGIVTELI-EGDVYHWGALMAGALL 269 Query: 282 AMLPVLAAYIIFQRQVVQGLTAGALK 307 LPV Y F V G+T GA+K Sbjct: 270 GSLPVALVYSFFVEYYVSGMT-GAVK 294 Lambda K H 0.326 0.141 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 278 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 295 Length adjustment: 27 Effective length of query: 280 Effective length of database: 268 Effective search space: 75040 Effective search space used: 75040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory