Align Putative TRAP dicarboxylate transporter, DctM subunit (characterized, see rationale)
to candidate RR42_RS06530 RR42_RS06530 C4-dicarboxylate ABC transporter
Query= uniprot:Q88NP0 (426 letters) >FitnessBrowser__Cup4G11:RR42_RS06530 Length = 434 Score = 258 bits (660), Expect = 2e-73 Identities = 149/426 (34%), Positives = 234/426 (54%), Gaps = 7/426 (1%) Query: 3 AFILLGSFIVLILIGMPVAYALGLSALIGAWWIDIPLQ-----AMMIQVASGVNKFSLLA 57 A IL F+ L+++G+P+ +LGL L+ ++ Q A+ +G+ K+ LLA Sbjct: 5 AIILFVVFLGLMMLGVPIGVSLGLGGLVAIGLSNLDTQMFGLLAVPQNFYAGLGKYPLLA 64 Query: 58 IPFFVLAGAIMAEGGMSRRLVAFAGVLVGFVRGGLSLVNIMASTFFGAISGSSVADTASV 117 IP FVL G+I G+++RLV FA +VG G L LV I+ + F G ISGS A+ A+V Sbjct: 65 IPMFVLVGSIFDRSGVAQRLVTFAIAIVGRGPGMLPLVAILVAMFLGGISGSGPANAAAV 124 Query: 118 GSVLIPEMERKGYPREFSTAVTVSGSVQALLTPPSHNSVLYSLAAGGTVSIASLFMAGIM 177 G V+I M R GYP +S AV + + +L PPS ++YS+ G S+ +LF AG++ Sbjct: 125 GGVMIAAMSRAGYPGAYSAAVVGAAAATDILIPPSVAFIIYSVLVPGA-SVPALFAAGMI 183 Query: 178 PGLLLSAVMMGLCLIFAKKRNYPKGEV-IPLREALKIAGEALWGLMAMVIILGGILSGVF 236 PG+L ++ + A+K N E +P K EA WGL+A +ILGG+ +G F Sbjct: 184 PGILAGVALIVPAVWLARKHNMGAIEAGLPRPPFWKSLREAAWGLVAPFLILGGMRAGWF 243 Query: 237 TATESAAVAVVWSFFVTMFIYRDYKWRDLPKLMHRTVRTISIVMILIGFAASFGYVMTLM 296 T TE+A VAVV+ FV M IYR RDL + T +++++++ A F Y ++ + Sbjct: 244 TPTEAAVVAVVYGLFVGMVIYRSISMRDLFVIFQEAAETSAVILLVVALAGIFAYALSTL 303 Query: 297 QIPSKITTAFLTLSDNRYVILMCINFMLMLLGTVMDMAPLILILTPILLPVITGIGVDPV 356 + + A Y +L I +LM +G +D + LI P+LLP+ +PV Sbjct: 304 GVIDPLANAIAHSGLGEYGVLALIVALLMTVGMFLDGISIFLIFVPLLLPIANAFHWNPV 363 Query: 357 HFGMIMLVNLGIGLITPPVGAVLFVGSAIGKVSIESTVKALMPFYLALFLVLMAVTYIPA 416 FG+++ + + +G TPP+ L V I +V +E TV ++ LA+F+ ++ V P Sbjct: 364 WFGVVLTLKVALGQFTPPLAVNLMVSCRIARVRMEETVPWVVWMLLAMFVAMLLVLAFPP 423 Query: 417 ISLWLP 422 ++ WLP Sbjct: 424 LATWLP 429 Lambda K H 0.329 0.142 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 591 Number of extensions: 43 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 434 Length adjustment: 32 Effective length of query: 394 Effective length of database: 402 Effective search space: 158388 Effective search space used: 158388 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory