Align Solute-binding protein Bamb_6123 (characterized)
to candidate RR42_RS10600 RR42_RS10600 C4-dicarboxylate ABC transporter substrate-binding protein
Query= SwissProt::Q0B2F6 (328 letters) >FitnessBrowser__Cup4G11:RR42_RS10600 Length = 343 Score = 132 bits (333), Expect = 9e-36 Identities = 80/259 (30%), Positives = 133/259 (51%), Gaps = 5/259 (1%) Query: 60 DSIKV--FGNSALGSEKDTVDQVRIGAIDMARVNGASFNEIVPESLIPSFPFLFRDVDHF 117 DSI+V F N+ LG E D V QV++G+IDM + + I PE + +LF +H Sbjct: 66 DSIRVDYFPNNQLGKESDVVQQVKVGSIDMMVTGSSIWATIAPELGMLDLGYLFDSYNHV 125 Query: 118 RKAMYGPAGQKILDAFAAKGMIALTFYES--GARSIYAKRPVRTPADMKGLKVRVQPSDL 175 + + G AG + + + + S GARS+Y KR V++ AD++G+K+RV P+ Sbjct: 126 ARVLDGAAGASLNQLLRKRSDCTILTWASHFGARSVYTKRAVKSLADIRGVKLRVLPTPS 185 Query: 176 MVDEIRAMGGTPTPMPFAEVYTGLKTGLVDAAENNLPSYEETKHFEVAPDYSETQHAMTP 235 ++ + MG PTP+PF E+Y +TG+VD E++ + +K EV ++H +P Sbjct: 186 FIETFKLMGAIPTPIPFGELYMAAQTGVVDGFEHDAATVLASKLNEVVKFCWLSEHLFSP 245 Query: 236 EVLVFSKKIWDTLSPQEQAAIRKAAADSVPYYQKLWTAREASAQQAVTKGGANILPAAQV 295 V+V ++ D + + A KA AD+ + + + + Q + + G P A Sbjct: 246 MVVVIGRRGMDKIPASLRPAFLKAVADATAQERVIAQSNGSVVVQELKRKGVTFFPMAPA 305 Query: 296 DRAAFVKAMQ-PLWTKYEK 313 +R A K M+ LW + K Sbjct: 306 ERVAVRKQMENTLWAGFAK 324 Lambda K H 0.318 0.131 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 343 Length adjustment: 28 Effective length of query: 300 Effective length of database: 315 Effective search space: 94500 Effective search space used: 94500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory