Align 5-keto-4-deoxy-D-glucarate aldolase; KDGluc aldolase; KDGlucA; 2-dehydro-3-deoxy-D-glucarate aldolase; 2-keto-3-deoxy-D-glucarate aldolase; 5-dehydro-4-deoxy-D-glucarate aldolase; Alpha-keto-beta-deoxy-D-glucarate aldolase; EC 4.1.2.20 (characterized)
to candidate RR42_RS29120 RR42_RS29120 alpha-dehydro-beta-deoxy-D-glucarate aldolase
Query= SwissProt::P23522 (256 letters) >FitnessBrowser__Cup4G11:RR42_RS29120 Length = 255 Score = 335 bits (860), Expect = 4e-97 Identities = 162/248 (65%), Positives = 198/248 (79%) Query: 7 PNKFKAALAAKQVQIGCWSALSNPISTEVLGLAGFDWLVLDGEHAPNDISTFIPQLMALK 66 PN+F+A + A + IGCW +L N +TE+LGLAGFDWL+LDGEH+PND+ TFIPQLMAL+ Sbjct: 6 PNRFRADVLAHKRVIGCWCSLGNATTTEILGLAGFDWLLLDGEHSPNDVLTFIPQLMALQ 65 Query: 67 GSASAPVVRVPTNEPVIIKRLLDIGFYNFLIPFVETKEEAELAVASTRYPPEGIRGVSVS 126 GS SAPVVR P N+PV+IKRLLDIGFYNFLIPFVE+ E+A AV++TRYPP G+RGVS + Sbjct: 66 GSVSAPVVRPPANDPVLIKRLLDIGFYNFLIPFVESAEQAGRAVSATRYPPAGVRGVSSA 125 Query: 127 HRANMFGTVADYFAQSNKNITILVQIESQQGVDNVDAIAATEGVDGIFVGPSDLAAALGH 186 R+N +GTV +YF+Q N NI +LVQIES++GVD D I A +GVDGIF+GP+DLAAA GH Sbjct: 126 QRSNRYGTVPEYFSQINDNICVLVQIESRKGVDAADEICAVDGVDGIFIGPNDLAAAYGH 185 Query: 187 LGNASHPDVQKAIQHIFNRASAHGKPSGILAPVEADARRYLEWGATFVAVGSDLGVFRSA 246 LGN +HP+VQ + IF A GK G L PVEADARRYL+ GA+FVAVG D G+FR+A Sbjct: 186 LGNPNHPEVQAQVARIFAAARRAGKAVGTLTPVEADARRYLDMGASFVAVGVDQGLFRTA 245 Query: 247 TQKLADTF 254 TQ L D F Sbjct: 246 TQALRDRF 253 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 255 Length adjustment: 24 Effective length of query: 232 Effective length of database: 231 Effective search space: 53592 Effective search space used: 53592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate RR42_RS29120 RR42_RS29120 (alpha-dehydro-beta-deoxy-D-glucarate aldolase)
to HMM TIGR03239 (garL: 2-dehydro-3-deoxyglucarate aldolase (EC 4.1.2.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03239.hmm # target sequence database: /tmp/gapView.5909.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03239 [M=249] Accession: TIGR03239 Description: GarL: 2-dehydro-3-deoxyglucarate aldolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-143 461.9 0.0 2.9e-143 461.8 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS29120 RR42_RS29120 alpha-dehydro-beta- Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS29120 RR42_RS29120 alpha-dehydro-beta-deoxy-D-glucarate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 461.8 0.0 2.9e-143 2.9e-143 1 247 [. 7 253 .. 7 255 .] 1.00 Alignments for each domain: == domain 1 score: 461.8 bits; conditional E-value: 2.9e-143 TIGR03239 1 nrfrqkllarktliglwsalgnpitaevlglagfdwllldgehapndvltlipqlmalkdsasapvvrv 69 nrfr+++la+k++ig+w++lgn t+e+lglagfdwllldgeh+pndvlt+ipqlmal++s+sapvvr+ lcl|FitnessBrowser__Cup4G11:RR42_RS29120 7 NRFRADVLAHKRVIGCWCSLGNATTTEILGLAGFDWLLLDGEHSPNDVLTFIPQLMALQGSVSAPVVRP 75 9******************************************************************** PP TIGR03239 70 plnepviikrlldigfynllipfvesaeeaeravaatryppegirgvsvaqrsnrygtvadyfkkindn 138 p+n+pv+ikrlldigfyn+lipfvesae+a rav+atrypp+g+rgvs aqrsnrygtv++yf +indn lcl|FitnessBrowser__Cup4G11:RR42_RS29120 76 PANDPVLIKRLLDIGFYNFLIPFVESAEQAGRAVSATRYPPAGVRGVSSAQRSNRYGTVPEYFSQINDN 144 ********************************************************************* PP TIGR03239 139 itvlvqiesrkgvdavdeiaavdgvdgvfvgpsdlaaalgylgnpnhpdvqkairhifdraaahgkavg 207 i+vlvqiesrkgvda dei+avdgvdg+f+gp+dlaaa+g+lgnpnhp+vq+ + +if++a+++gkavg lcl|FitnessBrowser__Cup4G11:RR42_RS29120 145 ICVLVQIESRKGVDAADEICAVDGVDGIFIGPNDLAAAYGHLGNPNHPEVQAQVARIFAAARRAGKAVG 213 ********************************************************************* PP TIGR03239 208 ilapveadarrylelgatfvavgsdlgvfrsatkalsekf 247 +l+pveadarryl++ga+fvavg d g+fr at+al+++f lcl|FitnessBrowser__Cup4G11:RR42_RS29120 214 TLTPVEADARRYLDMGASFVAVGVDQGLFRTATQALRDRF 253 ***************************************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (249 nodes) Target sequences: 1 (255 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 6.49 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory