Align tartronate semialdehyde reductase 2 (characterized)
to candidate RR42_RS19860 RR42_RS19860 tartronate semialdehyde reductase
Query= ecocyc::G6278-MONOMER (292 letters) >FitnessBrowser__Cup4G11:RR42_RS19860 Length = 308 Score = 389 bits (1000), Expect = e-113 Identities = 201/297 (67%), Positives = 234/297 (78%), Gaps = 7/297 (2%) Query: 3 LGFIGLGIMGTPMAINLARAGHQLHVTTIGPVADELLSLGAVSVETARQVTEASDIIFIM 62 +GFIGLGIMG PMA +L AGH L V + P L+ G +A +V + +DII IM Sbjct: 7 VGFIGLGIMGAPMAGHLRAAGHTLFVHDVNPAPQALVDAGVTVCTSAEEVAKRADIIVIM 66 Query: 63 VPDTPQVEEVLFGENGCT-------KASLKGKTIVDMSSISPIETKRFARQVNELGGDYL 115 VPDTP VE VLF E G K + GK +VDMSSISPI TK FA +VN+LG YL Sbjct: 67 VPDTPHVEAVLFAEKGVAAALKGAGKQAAHGKIVVDMSSISPIATKDFAARVNKLGAAYL 126 Query: 116 DAPVSGGEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVGGNGDGQTCKVANQII 175 DAPVSGGE+GA+ +L+IMVGG + F+ VKPLF+LLGKN+TLVGGNGDGQT KVANQII Sbjct: 127 DAPVSGGEVGAKAASLTIMVGGPQESFDEVKPLFDLLGKNVTLVGGNGDGQTTKVANQII 186 Query: 176 VALNIEAVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMIKRTFNPGFKIALH 235 VALNI+AVSEALLFASKAGADP RVRQALMGGFA+SRILEVHGERM+KRTF+PGF+I LH Sbjct: 187 VALNIQAVSEALLFASKAGADPARVRQALMGGFAASRILEVHGERMVKRTFDPGFRIELH 246 Query: 236 QKDLNLALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSALVQALELMANHKLA 292 QKDLNLALQ AKAL + LPNTAT QELFNTCAANG + DHSAL +A+E+M+NH++A Sbjct: 247 QKDLNLALQGAKALGVALPNTATAQELFNTCAANGLGKQDHSALCRAIEIMSNHEIA 303 Lambda K H 0.318 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 308 Length adjustment: 27 Effective length of query: 265 Effective length of database: 281 Effective search space: 74465 Effective search space used: 74465 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate RR42_RS19860 RR42_RS19860 (tartronate semialdehyde reductase)
to HMM TIGR01505 (2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01505.hmm # target sequence database: /tmp/gapView.23121.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01505 [M=291] Accession: TIGR01505 Description: tartro_sem_red: 2-hydroxy-3-oxopropionate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-127 410.5 9.6 2.1e-127 410.3 9.6 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS19860 RR42_RS19860 tartronate semialde Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS19860 RR42_RS19860 tartronate semialdehyde reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 410.3 9.6 2.1e-127 2.1e-127 2 291 .] 7 302 .. 6 302 .. 0.97 Alignments for each domain: == domain 1 score: 410.3 bits; conditional E-value: 2.1e-127 TIGR01505 2 vgfiGlGimGkPmsknllkaGyqlvvatleqealdellaaGaesaetakevvedadvivtmvPdsPqve 70 vgfiGlGimG Pm+ l aG+ l v +++ +a + l+ aG ++ +a+ev++ ad+iv+mvPd+P+ve lcl|FitnessBrowser__Cup4G11:RR42_RS19860 7 VGFIGLGIMGAPMAGHLRAAGHTLFVHDVN-PAPQALVDAGVTVCTSAEEVAKRADIIVIMVPDTPHVE 74 9*****************************.89999********************************* PP TIGR01505 71 evalGenGil.......eaakkGkvlvdmssiaPleskelakavkekGidvldaPvsGGeagaiegtls 132 +v++ e+G+ ++a +Gk++vdmssi+P+++k++a v+++G +ldaPvsGGe+ga+ + l+ lcl|FitnessBrowser__Cup4G11:RR42_RS19860 75 AVLFAEKGVAaalkgagKQAAHGKIVVDMSSISPIATKDFAARVNKLGAAYLDAPVSGGEVGAKAASLT 143 *******986333333345778*********************************************** PP TIGR01505 133 imvGGdkavfdkvkpllealgksivlvGenGaGqtvkvanqvivalnieavsealvlaekaGvdpkavl 201 imvGG + fd+vkpl+++lgk+++lvG+nG+Gqt+kvanq+ivalni+avseal++a+kaG+dp +v+ lcl|FitnessBrowser__Cup4G11:RR42_RS19860 144 IMVGGPQESFDEVKPLFDLLGKNVTLVGGNGDGQTTKVANQIIVALNIQAVSEALLFASKAGADPARVR 212 ********************************************************************* PP TIGR01505 202 qalrGGlagstvleakkerlldrdfkPGfridlhqkdlalaldaakavgaalPvtavvaellaalradG 270 qal+GG+a+s++le+++er+++r+f+PGfri+lhqkdl+lal+ aka+g+alP+ta+ +el+++++a+G lcl|FitnessBrowser__Cup4G11:RR42_RS19860 213 QALMGGFAASRILEVHGERMVKRTFDPGFRIELHQKDLNLALQGAKALGVALPNTATAQELFNTCAANG 281 ********************************************************************* PP TIGR01505 271 dgtldhsalvraleklakdkv 291 g+ dhsal ra+e ++++++ lcl|FitnessBrowser__Cup4G11:RR42_RS19860 282 LGKQDHSALCRAIEIMSNHEI 302 ******************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (291 nodes) Target sequences: 1 (308 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 9.35 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory