Align glutamate-aspartate periplasmic-binding protein (characterized)
to candidate RR42_RS07775 RR42_RS07775 ABC transporter substrate-binding protein
Query= CharProtDB::CH_002441 (302 letters) >FitnessBrowser__Cup4G11:RR42_RS07775 Length = 297 Score = 260 bits (664), Expect = 3e-74 Identities = 132/293 (45%), Positives = 188/293 (64%), Gaps = 6/293 (2%) Query: 7 ATAILALALSAGLAQADDAAPAAGSTLDKIAKNGVIVVGHRESSVPFSYYDNQQKVVGYS 66 AT ++A L G A+ TL+KIA + I V +RE++VPFSY K VG+S Sbjct: 8 ATMLIAAGLPLG------ASDLYAQTLEKIASSDTITVSYREAAVPFSYLLAPHKAVGFS 61 Query: 67 QDYSNAIVEAVKKKLNKPDLQVKLIPITSQNRIPLLQNGTFDFECGSTTNNVERQKQAAF 126 D + AIV+ V+ +L KP L+V +P+T QNRIP+L +GT+D ECGSTTN R K+ AF Sbjct: 62 VDLTEAIVDEVRARLKKPHLKVDYVPVTGQNRIPMLVSGTYDLECGSTTNTSARGKEVAF 121 Query: 127 SDTIFVVGTRLLTKKGGDIKDFANLKDKAVVVTSGTTSEVLLNKLNEEQKMNMRIISAKD 186 S +F GTRLLTKK IK++++L K V T+G+T+E LLNK + + ++++ +S KD Sbjct: 122 SINVFYAGTRLLTKKSSGIKNYSDLTKKTVASTAGSTNEKLLNKFSADHNLDIQFVSGKD 181 Query: 187 HGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDNWEIVGKPQSQEAYGCMLRKDDPQFK 246 + D+ + + + RAVA +DD LL G RA + P EIVG E Y CM+RKDD +FK Sbjct: 182 YADAMQLVLNDRAVALALDDVLLFGLRANSGNPSALEIVGDTLQVEPYACMVRKDDTEFK 241 Query: 247 KLMDDTIAQVQTSGEAEKWFDKWFKNPIPPKNLNMNFELSDEMKALFKEPNDK 299 KL+D TI ++ SGE + + KWF++PIPP N+N +SD ++A K +DK Sbjct: 242 KLVDGTITRLMKSGEFARLYKKWFESPIPPAGANLNMPMSDALRANIKARSDK 294 Lambda K H 0.314 0.130 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 297 Length adjustment: 27 Effective length of query: 275 Effective length of database: 270 Effective search space: 74250 Effective search space used: 74250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory