Align Proton/glutamate-aspartate symporter; Glutamate-aspartate carrier protein; Proton-glutamate-aspartate transport protein (characterized)
to candidate RR42_RS19790 RR42_RS19790 C4-dicarboxylate ABC transporter
Query= SwissProt::P21345 (437 letters) >FitnessBrowser__Cup4G11:RR42_RS19790 Length = 473 Score = 318 bits (815), Expect = 2e-91 Identities = 173/418 (41%), Positives = 263/418 (62%), Gaps = 16/418 (3%) Query: 7 SLAWQILFAMVLGILLGSYLHYHSDSRDWLVVNLLSPAGDIFIHLIKMIVVPIVISTLVV 66 SL Q+L A+VLG LG + L P GD FI LIKM++ PIV +V Sbjct: 27 SLFGQVLVALVLGTALGLLFPEFAAK--------LKPLGDAFIKLIKMLIGPIVFCVVVA 78 Query: 67 GIAGVGDAKQLGRIGAKTIIYFEVITTVAIILGITLANVFQPGAGVDMSQLATVD---IS 123 GI G G+ K++GR+G K ++YFEV+TT+A+ LGI LA +F PG G++++ A++D +S Sbjct: 79 GICGAGELKKVGRVGIKAVLYFEVVTTIALALGIALAYIFHPGTGMNVNP-ASLDASAMS 137 Query: 124 KYQSTTEAVQSSSHGIMGTILSLVPTNIVASMAKGEMLPIIFFSVLFGLGLSSLPATHRE 183 Y T + V+S+ G++ +L L+P+ ++ + A G++L ++ S+LFG LS L + Sbjct: 138 AYVDTAQKVKSA--GMVDFLLKLIPSTVMGAFASGDVLQVLLVSILFGCALS-LVGERGQ 194 Query: 184 PLVTVFRSISETMFKVTHMVMRYAPVGVFALIAVTVANFGFSSLWPLAKLVLLVHFAILF 243 PLVT+ + S T+FK+ +++ AP+GV +A TV +G SL L LVL+ + A+ Sbjct: 195 PLVTIIDTFSHTLFKMMGFIIKLAPLGVLGAVAFTVGKYGIGSLKQLGYLVLVFYGAVAL 254 Query: 244 FALVVLGIVARLCGLSVWILIRILKDELILAYSTASSESVLPRIIEKMEAYGAPVSITSF 303 F +VVLG V RLCG SV+ LIR L+ EL++ TASS+SVLP++++K+E G S+ Sbjct: 255 FVMVVLGTVMRLCGFSVFKLIRYLRAELLVVLGTASSDSVLPQVMKKLEFLGIKKSVVGL 314 Query: 304 VVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSIWQEIILVLTLMVTSKGIAGVPGVSFV 363 V+PTGYSFNLD ++Y ++AA+FIAQ L++ + ++ +VTSKG G+PG + V Sbjct: 315 VIPTGYSFNLDAFSIYLTLAAVFIAQATNTPLALGDLLGILAVALVTSKGAHGIPGSAIV 374 Query: 364 VLLATLGS-VGIPLEGLAFIAGVDRILDMARTALNVVGNALAVLVIAKWEHKFDRKKA 420 +L ATL + IP GL + VD + +AR N++GN +A +V+A WE DR +A Sbjct: 375 ILAATLSAHPAIPAIGLVLVLSVDWFIGIARAVGNLIGNCVATVVVAAWEKDIDRARA 432 Lambda K H 0.326 0.141 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 519 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 437 Length of database: 473 Length adjustment: 33 Effective length of query: 404 Effective length of database: 440 Effective search space: 177760 Effective search space used: 177760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory