Align (S)-citramalyl-CoA lyase (EC 4.1.3.25); (R)-citramalyl-CoA lyase (EC 4.1.3.46) (characterized)
to candidate RR42_RS24350 RR42_RS24350 malyl-CoA thiolesterase
Query= BRENDA::A0A172MLA1 (322 letters) >FitnessBrowser__Cup4G11:RR42_RS24350 Length = 292 Score = 130 bits (327), Expect = 4e-35 Identities = 89/286 (31%), Positives = 134/286 (46%), Gaps = 19/286 (6%) Query: 3 SRNTLRRALLYIPGSSQRFIDKSRTLTADCVAYDLEDSVTPHKKAEARSLVRRALDQPAP 62 SRN RR++LY PG++ R ++K++ L AD DLED+V P K +AR V RA++ Sbjct: 2 SRNRHRRSVLYTPGANVRALEKAKLLNADGFILDLEDAVAPDAKEDARENVARAIESGGY 61 Query: 63 AGILERAVRINSVDSGLALADLTEVLQSPNLSTIVIPKVNSASDLTFVTDVITHTLSQLP 122 G E VRINS+D+ DL E++ IVIPKV SA ++ V ++ Sbjct: 62 GG-KEVLVRINSLDTKWGKGDL-EIVARSAADGIVIPKVESAENVREVRAIMIEV----- 114 Query: 123 LSQSASRPPISLLALVESAKSLTNLSQICAASPLLQGLIFAAEDFALDLSLTRTPALTEF 182 + + + ++E+ + + +I + L GLI D A +L T Sbjct: 115 ----GAPESMRIWCMIETPRGVLRAEEIAGSDAQLGGLIMGTSDLAKELGCAHTRMRLPM 170 Query: 183 LFARSAIATAARAANLPSTIDLVCTTYKSDKGDGSPPVVLQQECRDGKNLGFNGKQCIHP 242 L + ARA L S +D V KG Q C G+ GFNGK IHP Sbjct: 171 LASLGRCVLVARAYGL-SILDGVHLDLDDAKG-------FQLSCEQGREFGFNGKTLIHP 222 Query: 243 SQVSTVQQIFGPELEEVQWAVRVTIADDKASKAGRGAWTLDGKMID 288 + +IF P +E+ WA ++ A + G+G +DG +I+ Sbjct: 223 KTIDKANEIFSPNQDELNWAKKIIAAYRQGVAEGKGVVVVDGHLIE 268 Lambda K H 0.316 0.130 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 322 Length of database: 292 Length adjustment: 27 Effective length of query: 295 Effective length of database: 265 Effective search space: 78175 Effective search space used: 78175 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory