Align (S)-citramalyl-CoA lyase (EC 4.1.3.25) (characterized)
to candidate RR42_RS36610 RR42_RS36610 host specificity protein
Query= BRENDA::Q9I562 (275 letters) >FitnessBrowser__Cup4G11:RR42_RS36610 Length = 292 Score = 187 bits (476), Expect = 2e-52 Identities = 117/275 (42%), Positives = 161/275 (58%), Gaps = 13/275 (4%) Query: 10 LFVPATRPERIPKALASGADRVIVDLEDAVEEGLKVEARANLRRFLVDT-PEARVLVRIN 68 LFVP RPER KA A+ D +I+DLEDAV K AR + +L++ + R VRIN Sbjct: 14 LFVPGDRPERFDKAAAAAPDALILDLEDAVHPHAKPAARTAIAAWLLERGTQTRAYVRIN 73 Query: 69 AAEHPGHADDLALCR---DHAGVIGLLLPKVESAAQVRHAA--VASGKP---VWPIVESA 120 A P A D+A R A + GLL+PK E A + A +A P + I+ESA Sbjct: 74 DASSPAFAADMAWLRALPPGAPLAGLLVPKAEDPAALGEIAQALAQANPQGRLVAIIESA 133 Query: 121 RGLAALGEIAAAAGVERLSFGSLDLALDLDLNSGSNAAEQILGHARYALLLQTRLAGLAP 180 GL + +A A GV RL+FGSLD A+DL G + L AR ++L +R+AGL P Sbjct: 134 CGLHGIDAVATAQGVSRLAFGSLDFAVDL----GCAHTREALLMARSRIVLASRVAGLPP 189 Query: 181 PLDGVYPAIQNRAGLVEAVRFARDMGFGGLLCIHPSQVEPIHQTLMPSPAELEWARRVAE 240 P+DGV A+++ A L + V AR +GF LCIHP+Q+ + +P+ +L+WA+RV + Sbjct: 190 PVDGVTTALKDEAVLADDVAHARALGFAAKLCIHPAQLAAVRAGFLPTAEQLDWAQRVLD 249 Query: 241 AGASGAGVFVVDGEMVDAPVLGRARRLLERAGEGG 275 A ASG+ VDG+MVD PV+ +ARR+L A G Sbjct: 250 ATASGSHAVQVDGKMVDRPVIEQARRMLALAAPTG 284 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 292 Length adjustment: 26 Effective length of query: 249 Effective length of database: 266 Effective search space: 66234 Effective search space used: 66234 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory