Align alcohol dehydrogenase (EC 1.1.1.1); long-chain-alcohol dehydrogenase (EC 1.1.1.192) (characterized)
to candidate RR42_RS11005 RR42_RS11005 4-hydroxybutyrate dehydrogenase
Query= BRENDA::A4IP64 (395 letters) >FitnessBrowser__Cup4G11:RR42_RS11005 Length = 382 Score = 177 bits (449), Expect = 5e-49 Identities = 118/359 (32%), Positives = 190/359 (52%), Gaps = 24/359 (6%) Query: 13 HVGWGALDQLVPEVKRLGAKHILVITDPMLVKIGLVDQVTSPLRQEGYSVHVYTDVVPEP 72 H+ +G + QL E +R+G + LV+TD +V G+ Q L G H D P Sbjct: 11 HLDFGTISQLKAECERIGIRRPLVVTDKGVVAAGVAQQAIVAL---GGLPHEIFDETPSN 67 Query: 73 PLETG-EKAVAFARDGKFDLVIGVGGGSALDLAKLAAVLAVHDGSVADYLNLTG-TRTLE 130 P E +KA A RD D +I VGGGS++DLAK A+LA H G + Y + G + L Sbjct: 68 PTEAMVKKAAAQYRDSGCDGLIAVGGGSSIDLAKGIAILATHPGELTTYATIEGGSARLT 127 Query: 131 KKGLPKILIPTTSGTGSEVTNISVLSLETTKDVVTHDY-LLADVAIVDPQLTVSVPPRVT 189 ++ P I +PTTSGTGSEV +++ LE + + H + LL AI DP LT+ +P +T Sbjct: 128 ERAAPLIAVPTTSGTGSEVARGAIIILEDGRKLGFHSWHLLPKSAICDPGLTLGLPAGLT 187 Query: 190 AATGIDALTHAVEAYVSVNASPTSDGLAVAAIRLISRSLRKAVANGSDKQARIDMANGSY 249 AATG+DA+ H VE +++ +P +DG+A+ + + + +A +G D+ AR++M + S Sbjct: 188 AATGMDAIAHCVETFLAPAFNPPADGIALDGLERGWKHIERATRDGQDRDARLNMMSAS- 246 Query: 250 LAGLAFFNAGVAGVHALAYPLG-----GQFHIAHGESNAVLLPYVMGYIRQSCT----KR 300 + G F G+ VH+L++PLG G+ + HG NAV++P V+ + + + R Sbjct: 247 MQGAMAFQKGLGCVHSLSHPLGGLKVDGKTGLHHGTLNAVVMPAVLRFNADAPSVVRDNR 306 Query: 301 MADIFNALGGNSSFLSEVEASYRCVEELERFVADVGIPKTLGGFGIPESALESLTKDAV 359 A + +A+G + + + A +G+P L G+ E + + A+ Sbjct: 307 YARLRHAMG--------LPQDADLAQAVHDMTARLGLPTGLRQMGVTEDMFDKVIAGAL 357 Lambda K H 0.318 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 16 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 382 Length adjustment: 30 Effective length of query: 365 Effective length of database: 352 Effective search space: 128480 Effective search space used: 128480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory