Align Alpha-glycerophosphate oxidase; EC 1.1.3.21; Exported protein 6; Glycerol-3-phosphate oxidase (uncharacterized)
to candidate RR42_RS16760 RR42_RS16760 FAD-dependent oxidoreductase
Query= curated2:P35596 (608 letters) >FitnessBrowser__Cup4G11:RR42_RS16760 Length = 559 Score = 194 bits (492), Expect = 1e-53 Identities = 167/566 (29%), Positives = 256/566 (45%), Gaps = 87/566 (15%) Query: 8 RELSIKKMQERTLDLLIIGGGITGAGVALQAAASGLETGLIEMQDFAEGTSSRSTKLVHG 67 R+ + ++ T D+LI+GGG+TGA AL A+ G L+E DFA GTSS+S+K+VHG Sbjct: 26 RQAQLDRLGSETFDILIVGGGVTGAYAALDASLRGYRVALVEKNDFASGTSSKSSKMVHG 85 Query: 68 GLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKSDPMLLPVYDEDGATFSLFRLKVAMD-- 125 GLRY++Q ++ +V ++ ER +++ A H+ + P L PV ++DG RL A + Sbjct: 86 GLRYIEQGNLGLVRHSLLERQRLRRNARHLVQRLPFLFPVMEKDGVFDK--RLSKAFESL 143 Query: 126 --LYDLLAGVSNTPAANKVLSKDQVLERQPNLKKEGLVGGGVYLDFRNNDARLVIENIKR 183 YD LAG ++ L+K +VL P +E L+GG +Y D R +DARL + + Sbjct: 144 LWTYD-LAGGWREGILHQKLTKAEVLSHCPTFNEENLLGGFMYFDARVDDARLTLNIART 202 Query: 184 ANQDGALIANHVKAEGFLFDESGKITGVVARDLLTDQVFEIKARLVINTTGPWSDKVRNL 243 A GA + NH K + GK+ G + D+ +A +V+ TG W Sbjct: 203 AAFHGAAVVNHAKVVEITRNGHGKVDGAIIH--AGDREIRARAGVVVMATGVWLRDWTGR 260 Query: 244 SNKGTQFSQMRPTKGVHLVVDSSKIKVSQPVYFDTGLGDGRMVFVLPRENKTYFGTTDTD 303 + +RP KGVH+ + K++ V G R + N +Y GTTD D Sbjct: 261 KKGEEKTLHIRPAKGVHVAIPWLKVRNDCTVTIPVP-GRNRRATITRWGNVSYLGTTDED 319 Query: 304 YTGDLEHPKVTQEDVDYLLGIVNNRFPESNITIDDIESSWAGLRPLIAGNSASDYNGGNN 363 Y GDL++ T+E++D+LL ++++ +D+ S AG RPL+A GG Sbjct: 320 YEGDLDNVCCTREELDFLLDGARWAL-KTDLQAEDVLGSIAGCRPLVAP------PGG-- 370 Query: 364 GTISDESFDNLIATVESYLSKEKTREDVESAVSKLESSTSEKHLDPSAVSRGSSLDRDDN 423 KT E + R + + Sbjct: 371 ----------------------KTLE----------------------IKRNHEIHTAAD 386 Query: 424 GLLTLAGGKITDYRKMAEGAMERVVDILKAEFDRSFKLINSKTYPVSGGELNPANVDSEI 483 GL+T+ GGK+T R MAE ++ +L ++ S L A D++ Sbjct: 387 GLVTIVGGKLTTSRHMAEQTIDAAQKVLGQ---------RNRCQTKSAYLLGAAGYDAQ- 436 Query: 484 EAFAQLGVSRGLDSKEAHYLANLYGSNAPKVFAL--AHSLEQAP---GLSLADTLSLHYA 538 + S GL + +L YG+ A V + A + QAP GL + + YA Sbjct: 437 ----AIVASGGLSA----HLGERYGTEARFVSDILQADARLQAPIVEGLPYTEA-EIVYA 487 Query: 539 MRNELTLSPVDFLLRRTNHMLFMRDS 564 R+EL S D L RR L RD+ Sbjct: 488 ARHELAGSVDDVLSRRIRARLMARDA 513 Lambda K H 0.314 0.133 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 636 Number of extensions: 30 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 608 Length of database: 559 Length adjustment: 36 Effective length of query: 572 Effective length of database: 523 Effective search space: 299156 Effective search space used: 299156 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory