Align ABC transporter for Glycerol, ATPase component 1 (characterized)
to candidate RR42_RS22875 RR42_RS22875 ABC transporter
Query= reanno::acidovorax_3H11:Ac3H11_791 (363 letters) >FitnessBrowser__Cup4G11:RR42_RS22875 Length = 351 Score = 179 bits (453), Expect = 1e-49 Identities = 104/245 (42%), Positives = 144/245 (58%), Gaps = 2/245 (0%) Query: 7 SISKKVGAQTWLYDMSLALQSGAVTVLLGATQAGKTSLMRIMAGLDAPTAGRVTVDGKDV 66 S++K+ + + LA+ VLLG + +GKT+L+R++AGL+APT+G + V G+ V Sbjct: 8 SLTKRFDGTNAVDGIDLAVHEAEFLVLLGPSGSGKTTLLRLIAGLEAPTSGDILVGGRVV 67 Query: 67 TGMPVRDRNVAMVYQQFINYPSMKVAANIASPLKLRG--EKNIDARVREIASRLHIDMFL 124 TG+P R N+AMV+Q + YP + VA NIA PL+ + + I +V A+ I L Sbjct: 68 TGLPPRAHNMAMVFQSYALYPHLSVAGNIAFPLEAQRMPREAIARKVSWAAALFGIGHLL 127 Query: 125 DRYPAELSGGQQQRVALARALAKGAPLMLLDEPLVNLDYKLREELREELTQLFAAGQSTV 184 R P +LSGG++QRVALARA+ + LLDEPL NLD KLR REEL QL +T Sbjct: 128 SRKPRQLSGGERQRVALARAVVREPVAFLLDEPLSNLDAKLRTSAREELQQLQRRLATTT 187 Query: 185 VYATTEPGEALLLGGYTAVLDEGQLLQYGPTAEVFHAPNSLRVARAFSDPPMNLMAASAT 244 +Y T + EAL LG A+LD G++ Q G +V+ P VA PPMNL+ A Sbjct: 188 IYVTHDQIEALALGDRVAILDHGRVHQLGTPQQVYEQPADTFVATFIGSPPMNLVDTDAL 247 Query: 245 AQGVR 249 G R Sbjct: 248 VTGFR 252 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 351 Length adjustment: 29 Effective length of query: 334 Effective length of database: 322 Effective search space: 107548 Effective search space used: 107548 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory