Align ABC transporter for Glycerol, ATPase component 1 (characterized)
to candidate RR42_RS27800 RR42_RS27800 ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_791 (363 letters) >FitnessBrowser__Cup4G11:RR42_RS27800 Length = 357 Score = 166 bits (420), Expect = 9e-46 Identities = 115/291 (39%), Positives = 161/291 (55%), Gaps = 19/291 (6%) Query: 18 LYDMSLALQSGAVTVLLGATQAGKTSLMRIMAGLDAPTAGRVTVDG-KDVTGMPVRDRNV 76 L + L + +G VLLG + GKT+ +RI+AGL+ P AG V + G DVT +P+ R V Sbjct: 23 LQPLDLDIGAGETVVLLGPSGCGKTTTLRIIAGLEFPDAGGVVMFGDNDVTPLPIEQRGV 82 Query: 77 AMVYQQFINYPSMKVAANIASPLKLRGEKNIDA-----RVREIASRLHIDMFLDRYPAEL 131 MV+Q + +P+M VA NIA L++R IDA RV E+ + +H+ F +R +L Sbjct: 83 GMVFQSYALFPNMTVAENIAYGLRVR---RIDAAARRRRVDEMLAMMHLGPFAERRIDQL 139 Query: 132 SGGQQQRVALARALAKGAPLMLLDEPLVNLDYKLREELREELTQLFAAGQSTVVYATTEP 191 SGGQ+QRVALARA+A ++LLDEPL LD KLR+ LR ++ QL + T VY T + Sbjct: 140 SGGQRQRVALARAIAVQPRVLLLDEPLTALDAKLRDALRADINQLLRSLHITAVYVTHDQ 199 Query: 192 GEALLLGGYTAVLDEGQLLQYGPTAEVFHAPNSLRVARAFSDPPMNLMAASATAQGVRLQ 251 EA+ LG V+D G++ Q G +++ AP + VA MN + A A R+ Sbjct: 200 AEAMALGDRIIVMDRGRIAQTGTPQQIYRAPANAFVADFIG--TMNRLPAVLEADAWRVP 257 Query: 252 GGAELTLPLPQGAATAAGLTVGVRASALRVHARPGDVSVAGVVELAEISGS 302 GG L G A + RA L RP DV++A E A + GS Sbjct: 258 GG----LVPRHGTAASLAAAPSPRAELL---FRPEDVALA-QAEDAHLGGS 300 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 357 Length adjustment: 29 Effective length of query: 334 Effective length of database: 328 Effective search space: 109552 Effective search space used: 109552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory