Align GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate RR42_RS18590 RR42_RS18590 hypothetical protein
Query= TCDB::G3LHY9 (356 letters) >FitnessBrowser__Cup4G11:RR42_RS18590 Length = 359 Score = 198 bits (504), Expect = 2e-55 Identities = 119/319 (37%), Positives = 181/319 (56%), Gaps = 13/319 (4%) Query: 25 LKEVDHEWNDGGAYALLGPSGCGKTTLLNIISGLLQPSHGRILFDGKDVTNLSTQSRNIA 84 ++ VD + DG L+GPSGCGK+TLL +I+GL + + G I + V L + R+IA Sbjct: 19 IRGVDIDIADGQFTVLVGPSGCGKSTLLRMIAGLEEITTGEIAIGNRVVNRLPPKERDIA 78 Query: 85 QVFQFPVIYDTMTVYDNLAFPLRNRGVAEADVDRRVRDILEMIDLASWARRKAQGLTADQ 144 VFQ +Y MTVYDN+AF L+ + ++ R+V ++ L S R + L+ Q Sbjct: 79 MVFQNYALYPHMTVYDNMAFSLKLAKGDKEEIKRKVAKASAILGLDSLLERYPRQLSGGQ 138 Query: 145 KQKISLGRGLVRNDVNAILFDEPLTVIDPHMKWVLRSQLKRLHKQFGFTMVYVTHDQTEA 204 +Q++++GR +VR D LFDEPL+ +D ++ +R+++K LH++ T VYVTHDQ EA Sbjct: 139 RQRVAMGRAIVR-DPQVFLFDEPLSNLDAKLRVQMRAEIKELHQRLRTTSVYVTHDQIEA 197 Query: 205 LTFAEKVVVMYDGQIVQIGTPAELFERPSHTFVGYFIGSPGMNFMPARIEGS----TVKV 260 +T A+++VVM DG++ Q G P L++ P + FV FIGSP MNF+P + S V+ Sbjct: 198 MTMADQIVVMRDGRVEQRGKPLALYDHPDNLFVAGFIGSPAMNFVPGVLRRSGGDAAVEF 257 Query: 261 GDETLTLEYAPKTSGTAKTE-----LGIRPEFIRLGR--EGMPITISKVEDIGRQKIVRA 313 D T L + TA T+ G+RPE + LG +G+ +S VE G + + Sbjct: 258 PDGT-RLPAPARFDATAGTDGQRVIYGVRPEHLTLGMPGQGLQTRVSVVEPTGANTEIYS 316 Query: 314 RFADQPIAIVVPEDADIPA 332 RF + + E D A Sbjct: 317 RFCEAEFISIFRERHDFAA 335 Lambda K H 0.321 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 359 Length adjustment: 29 Effective length of query: 327 Effective length of database: 330 Effective search space: 107910 Effective search space used: 107910 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory