Align ABC transporter for L-Histidine, permease component 1 (characterized)
to candidate RR42_RS04400 RR42_RS04400 ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_2554 (222 letters) >FitnessBrowser__Cup4G11:RR42_RS04400 Length = 219 Score = 162 bits (410), Expect = 5e-45 Identities = 86/212 (40%), Positives = 140/212 (66%), Gaps = 1/212 (0%) Query: 8 VWAGVPQLLAGALVTVEITAASLLLGCVMGLLVGIGRLNPKRRVVYALCTAYVAAIRGTP 67 V +P LL G L+T++ S++ G V+G +V + ++ + V A+ AYV+ +RGTP Sbjct: 7 VATSLPVLLQGMLLTIKFALLSMIFGLVLGTVVALMGIS-HQPVPKAVARAYVSIMRGTP 65 Query: 68 LLVQLFILFFGLPQFGILLPAFVCGVIGLGIYSGAYVSEVVRGAIQSIDKGQMEAARSIG 127 LLVQ+F++++GLP GI L GV+ L + GAY+SE +RGAI I +GQ AA S+G Sbjct: 66 LLVQIFVVYYGLPGIGIALEPTPAGVLTLSLNVGAYLSESMRGAILGIPRGQWLAAYSLG 125 Query: 128 MSSGLAMRTVVLPQAVVRMIPPLGNEFIALIKNSALVSLLTIHDLMHEGQKIISVSYRSL 187 ++ G A+R V+ PQA+ +P L N I+LIK+++LVS++T+ +L+ Q++I+ +Y+ L Sbjct: 126 LTQGQALRYVIGPQALRLAVPSLSNSLISLIKDTSLVSVITVTELLRTAQEVIAATYQPL 185 Query: 188 EVYLAIAVVYFILTGATTLVLRRIELRLRAGG 219 +YLA+A +Y++L+ A + R +E RL G Sbjct: 186 PLYLAVAAIYWMLSTALAHMQRLLERRLSLPG 217 Lambda K H 0.328 0.143 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 219 Length adjustment: 22 Effective length of query: 200 Effective length of database: 197 Effective search space: 39400 Effective search space used: 39400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory