Align Polar amino acid ABC transporter, inner membrane subunit (characterized, see rationale)
to candidate RR42_RS29655 RR42_RS29655 amino acid ABC transporter permease
Query= uniprot:B2TBJ8 (250 letters) >FitnessBrowser__Cup4G11:RR42_RS29655 Length = 237 Score = 132 bits (331), Expect = 8e-36 Identities = 77/220 (35%), Positives = 123/220 (55%), Gaps = 2/220 (0%) Query: 14 QLLAAVPTTLGLFFCSLILGGLLSLVIVTMRVSPHWLPNRFARAYILVFRGSPLLIQMFL 73 Q + + TL L SL +G +L++ + R+S + + Y VFRG+PL +Q+ L Sbjct: 18 QGFSGLAVTLWLLDASLFIGFILAVPLAVARISKNKFLSVAVWCYTYVFRGTPLYVQLLL 77 Query: 74 VYYGMGQFGVIRES-FLWPVLREPYMCAVLSLALCTAGYTAEIIRGGLMAVPVGQIEAGY 132 +Y G+ F +R + L V R Y C++++ AL T YT EI G + G+IEA Sbjct: 78 IYTGLYGFEFVRSTEVLSAVFRSGYYCSIIAFALNTCAYTTEIFAGAMRTTNHGEIEAAR 137 Query: 133 SIGLSGFALLRRVIGPIALRQCLPAYSTEAVLLVKSTALASLVTVWEVTGVAQQIIQQTY 192 + G+S F + RR++ P ALR+ LP Y E +L++ +T++A TV ++ VA+ TY Sbjct: 138 AYGMSWFTMYRRIVIPSALRRSLPQYGNEVILMLHATSVAFTATVPDILKVARDANAATY 197 Query: 193 RTTEVFICAALIYLFLNFVIVRLLGMLETRLSRHLRAARP 232 ++ + F AAL+YL ++F +V L E R +L A RP Sbjct: 198 QSFQSFGIAALLYLAVSFALVALFRQAEQRWLAYL-AVRP 236 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 237 Length adjustment: 23 Effective length of query: 227 Effective length of database: 214 Effective search space: 48578 Effective search space used: 48578 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory