Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate RR42_RS07815 RR42_RS07815 glutamine ABC transporter ATP-binding protein
Query= TCDB::Q9HT70 (335 letters) >FitnessBrowser__Cup4G11:RR42_RS07815 Length = 243 Score = 176 bits (447), Expect = 4e-49 Identities = 99/215 (46%), Positives = 135/215 (62%), Gaps = 2/215 (0%) Query: 28 IQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGGRILVEGEDVTALDAEGLRRFRQRVGMI 87 I+ G++ LIG SG+GKST+LR IN LE+ GG I ++GE V A + G+R+ RQRV M+ Sbjct: 24 IRQGEVVCLIGPSGSGKSTMLRCINGLEQYQGGSITIDGERVNAA-SPGIRQIRQRVSMV 82 Query: 88 FQHFNLLSSKTVADNIAMPLRLAGGFSRAEVDARVSELLARVGLSDHARKYPAQLSGGQK 147 FQ FNL +T +N+ S AE R +E+LA VGL++ YP QLSGGQ+ Sbjct: 83 FQRFNLFPHRTALENVMEGPVHVKKESVAEAKERAAEILASVGLAEKMAHYPTQLSGGQQ 142 Query: 148 QRVGIARALACRPSILLCDEATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDVIRR 207 QRV IARALA RP +L DE TSALDP+ VL ++ ++ E +T+V++THEM R Sbjct: 143 QRVAIARALAMRPDAILFDEPTSALDPELVGEVLGVMRKL-AEKGMTMVIVTHEMKFARE 201 Query: 208 VCDQVAVMDGGAIVEQGDVADVFLHPQHPTTRRFV 242 V ++V +DGG I EQG A V P + + F+ Sbjct: 202 VSNRVLFLDGGRIAEQGPSAQVLTQPSNERMQDFL 236 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 243 Length adjustment: 26 Effective length of query: 309 Effective length of database: 217 Effective search space: 67053 Effective search space used: 67053 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory