Align Probable TonB-dependent receptor, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate RR42_RS32615 RR42_RS32615 methionine ABC transporter ATPase
Query= TCDB::Q9HT68 (260 letters) >FitnessBrowser__Cup4G11:RR42_RS32615 Length = 270 Score = 158 bits (400), Expect = 1e-43 Identities = 96/258 (37%), Positives = 147/258 (56%), Gaps = 10/258 (3%) Query: 12 AALGLTAAQAA-------ESLTVAATPVPHAEILNV-VKPLLAKEGVDLKIKEFTDYVQP 63 AAL L Q A + + AT P+++ + +KPLL K+G + I EF+DYVQP Sbjct: 12 AALALGVIQTAGAADPDKKEIRFGATAGPYSDQIRYGIKPLLEKKGYKVTIVEFSDYVQP 71 Query: 64 NVQVSEKRLDANFFQHQPYLDEFNKAKGTDLVAVTGVHIEPLGAYSSKYKKLDELPSGAT 123 N+ +++ +DAN FQH YL +F+ + L V V P+G YS K+K L E+ GA+ Sbjct: 72 NLALADGAIDANAFQHVAYLKKFSGDRKLQLSEVIQVPTAPIGIYSRKHKSLTEVRPGAS 131 Query: 124 VVIPNDATNGGRALLLLDKAGVIKLK-DNKSITATPKDIVDNPKNIKIRELEAATLPRVL 182 V +PND +N RA+ +L + G I LK I A+ +DI NP +K+ +LEAA LPR L Sbjct: 132 VSLPNDPSNLARAIAMLQQIGWITLKAGTDPIRASERDIEGNPNKLKLIQLEAAQLPRSL 191 Query: 183 TQVDMALINTNYALEAKLNPTKDALAIEGSDSPYVNILVARPDNKDSDAMQKLAKALHSA 242 VD A +N N+AL + L T +AL++E Y+N++ R + ++ + +A S Sbjct: 192 DDVDFAFVNGNFALSSGLKLT-EALSLEKIPDYYMNLVAVRTADTGKPFVKDIREAYQSP 250 Query: 243 EIKQFIQEKYKGAVVPAF 260 E K Q+++ G + PA+ Sbjct: 251 EFKATTQQRFAGFLPPAY 268 Lambda K H 0.314 0.131 0.354 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 270 Length adjustment: 25 Effective length of query: 235 Effective length of database: 245 Effective search space: 57575 Effective search space used: 57575 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory