Align ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 1 (characterized)
to candidate RR42_RS34310 RR42_RS34310 amino acid ABC transporter permease
Query= reanno::Smeli:SMc02119 (397 letters) >FitnessBrowser__Cup4G11:RR42_RS34310 Length = 222 Score = 91.3 bits (225), Expect = 2e-23 Identities = 70/205 (34%), Positives = 109/205 (53%), Gaps = 22/205 (10%) Query: 181 PIAEEGA----EYTLLAFVIAVAASVFFA--RYARKRQLATGERLPVLWTVLGLIIGLPL 234 PI +GA E T+LAFV++ + A + + R L+ G + +I GLP+ Sbjct: 14 PILLQGAVVTVEVTVLAFVLSSLLGLALALMKLSPARTLSWGAS-----GAINVIRGLPI 68 Query: 235 VTFLVTGAPITFDIPVAGKFNLTGGSVVGPEFMSLFLALSFYTAAFIAEIVRAGIRGVSK 294 + L I F +P AG +LT F + + L +A+ AE RAGI V Sbjct: 69 IVQLFY---IYFVLPDAG-IHLTA-------FQAGVIGLGIAYSAYQAENFRAGIEAVDP 117 Query: 295 GQTEAAHALGIRPALTTRLVVVPQAMRIIIPPLTSQYLNLTKNSSLAVAIGYADLVAVGG 354 GQ EAA A+G+RPAL R V++PQA+RI +PP + + + K+SSL I A++ G Sbjct: 118 GQREAAQAMGMRPALVMRRVILPQALRISLPPYGNTLVMMLKDSSLVSTITVAEMTRAGQ 177 Query: 355 TILNQTGQSIEIVSIWLIVYLSLSL 379 I + T Q++ + ++ ++YL +SL Sbjct: 178 LIASSTFQNMTVYTLVALLYLLMSL 202 Lambda K H 0.327 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 222 Length adjustment: 26 Effective length of query: 371 Effective length of database: 196 Effective search space: 72716 Effective search space used: 72716 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory