Align histidine ABC transporter, periplasmic histidine-binding protein HisJ (characterized)
to candidate RR42_RS34315 RR42_RS34315 ABC transporter substrate-binding protein
Query= CharProtDB::CH_014295 (260 letters) >FitnessBrowser__Cup4G11:RR42_RS34315 Length = 254 Score = 78.2 bits (191), Expect = 2e-19 Identities = 81/261 (31%), Positives = 120/261 (45%), Gaps = 26/261 (9%) Query: 2 KKLVLSLSLVLAFSSATAAFAAIPQNIRIGTDPTYAPF-----ESKNSQGELVGFDIDLA 56 ++ L L S A A AA N+ G T PF ++ QG +V + Sbjct: 8 RRAALILCAASTVSFAWAQGAAPTYNV--GATATGVPFTFLDVKTNTIQGMMVDTVTAVG 65 Query: 57 KELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRL 116 K +N Q T ALIPSL + KID I +++ T RQQ + F+D +YA L Sbjct: 66 KAGGFNVNVQQTV----FSALIPSLTSSKIDIISAAMLKTPARQQVVDFSDPVYAYGEGL 121 Query: 117 VVAKNSDIQP--TVESLKGKRVGVLQGTTQETFGNEHWAPKGI--EIVSYQGQDNIYSDL 172 +V K D +P +++ LKG+ VG GT N+ KGI E+ SY ++ DL Sbjct: 122 IV-KGDDNKPYASLDELKGEVVGAQVGTVFLDMLNK----KGIFKEVRSYDSVADMTRDL 176 Query: 173 TAGRIDAAFQDEVAASEGFLKQPVGKDYKFGGPSVKDEKLFGVG-TGMGLRKEDNELREA 231 T GRI A D + + + ++ G K VG + +RK D E Sbjct: 177 TLGRIKAGLGD-----QPIIAYQIRQNAFPGVKLAASYKPVNVGDVCLVVRKGDTETLAR 231 Query: 232 LNKAFAEMRADGTYEKLAKKY 252 +NKA A+++ADGT + +K+ Sbjct: 232 INKAIAKIKADGTLAGIIQKW 252 Lambda K H 0.315 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 135 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 254 Length adjustment: 24 Effective length of query: 236 Effective length of database: 230 Effective search space: 54280 Effective search space used: 54280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory