Align Histidine transport ATP-binding protein HisP (characterized)
to candidate RR42_RS07815 RR42_RS07815 glutamine ABC transporter ATP-binding protein
Query= SwissProt::P02915 (258 letters) >FitnessBrowser__Cup4G11:RR42_RS07815 Length = 243 Score = 248 bits (633), Expect = 8e-71 Identities = 131/243 (53%), Positives = 167/243 (68%), Gaps = 12/243 (4%) Query: 12 LHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNIN 71 L K YG H VL + + R G+V+ +IG SGSGKST LRCIN LE+ G+I ++G+ +N Sbjct: 7 LSKSYGAHRVLSNIDAEIRQGEVVCLIGPSGSGKSTMLRCINGLEQYQGGSITIDGERVN 66 Query: 72 LVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARE 131 A +R +R R++MVFQ FNL+ H T LENVME P+ V S +A+E Sbjct: 67 -----------AASPGIRQIRQRVSMVFQRFNLFPHRTALENVMEGPVHVKKESVAEAKE 115 Query: 132 RALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGE 191 RA + LA VG+ E+ YP LSGGQQQRV+IARALAM PD +LFDEPTSALDPELVGE Sbjct: 116 RAAEILASVGLAEK-MAHYPTQLSGGQQQRVAIARALAMRPDAILFDEPTSALDPELVGE 174 Query: 192 VLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQVFGNPQSPRLQQ 251 VL +M++LAE+G TMV+VTHEM FAR VS+ V+FL G+I E+G QV P + R+Q Sbjct: 175 VLGVMRKLAEKGMTMVIVTHEMKFAREVSNRVLFLDGGRIAEQGPSAQVLTQPSNERMQD 234 Query: 252 FLK 254 FL+ Sbjct: 235 FLR 237 Lambda K H 0.319 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 243 Length adjustment: 24 Effective length of query: 234 Effective length of database: 219 Effective search space: 51246 Effective search space used: 51246 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory