Align histidine transport ATP-binding protein hisP (characterized)
to candidate RR42_RS34305 RR42_RS34305 glutamine ABC transporter ATP-binding protein
Query= CharProtDB::CH_003210 (257 letters) >FitnessBrowser__Cup4G11:RR42_RS34305 Length = 252 Score = 252 bits (644), Expect = 5e-72 Identities = 136/248 (54%), Positives = 171/248 (68%), Gaps = 12/248 (4%) Query: 6 LNVIDLHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGSIVVN 65 + + +L K + +H VL+GVSL +AG+V+ +IG SGSGKST LRCIN LE G I Sbjct: 2 IRIDNLQKYFDDHHVLRGVSLHVDAGEVVCLIGPSGSGKSTVLRCINGLESYEGGEIRAF 61 Query: 66 GQTINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSK 125 G+ + D+ G+ + LR+R+ MVFQ FNL+ H +VLENVME P+ V G S+ Sbjct: 62 GERV----DRGGK-------DIHRLRSRMGMVFQRFNLFPHRSVLENVMEGPVYVKGESR 110 Query: 126 QEARERAVKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPTSALDP 185 +AR A++ L KVG+ +AQ YP LSGGQQQRV+IARALAM PE +LFDEPTSALDP Sbjct: 111 DKARSEAMELLEKVGLAAKAQA-YPPQLSGGQQQRVAIARALAMRPEAMLFDEPTSALDP 169 Query: 186 ELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSTHVIFLHQGKIEEEGAPEQLFGNPQS 245 ELVG+VL +M+ LA EG TM+VVTHEMGFAR V+ V FLH G I EEGA Q+ G P Sbjct: 170 ELVGDVLEVMRNLAREGMTMIVVTHEMGFAREVADRVCFLHSGTIVEEGAAAQVLGAPSH 229 Query: 246 PRLQRFLK 253 R Q FL+ Sbjct: 230 ARTQDFLR 237 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 252 Length adjustment: 24 Effective length of query: 233 Effective length of database: 228 Effective search space: 53124 Effective search space used: 53124 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory